KEGG   Burkholderia cenocepacia J2315: BCAM1570Help
Entry
BCAM1570          CDS       T00771                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCAM1570 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAM1570 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    BCAM1570 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCAM1570 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCAM1570 (adhA)
   00626 Naphthalene degradation
    BCAM1570 (adhA)
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCAM1570 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1747253..1748281)
Genome map
AA seq 342 aa AA seqDB search
MTQTMKAAVVHAFGAPLRIEEVPIPAPGPGQILVNIKASGVCHTDLHAADGDWPVKPSLP
FIPGHEGVGIVAAVGAGVTHVREGDRVGVPWLYTACGHCEYCCTGWETLCHGQQNTGYSV
NGSYAEYVLADPDYVGQLPAQVAFDEIAPILCAGVTVYKGIRVTDTRPGQWLAISGIGGL
GHVAVQYARAMGLHVAAIDISPDKLALARQLGAHLTIDASIDDPATVIQKEIGGAHGVLV
TAVSRSAFAQALGMVRRGGTVALNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAADGLVRAHIHRDRLGNINDVFAKLREGKVDGRIVLTDMH
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccatgaaagcggccgtggtacacgcgttcggcgcgccgttgcgcatcgag
gaagtgccgattccggcaccggggcccggccagattctcgtcaacatcaaggcgtcgggt
gtttgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgtcgctgccg
ttcatcccgggccatgaaggcgtggggatcgtcgcggcggtcggcgcgggcgtcacgcac
gtgcgcgagggcgatcgcgtcggcgtgccgtggctctatacggcctgcggccattgcgag
tactgctgcacgggctgggaaacgctctgccacggtcagcagaacaccggctattcggtg
aacggcagctacgcggaatacgtgctggccgatcccgactacgtcggccagttgcccgcg
caggtcgcgttcgacgagatcgcgccgatcctgtgcgcgggcgtcacggtctacaagggc
attcgcgtcaccgacacgcgcccgggccagtggctcgcgatttccggcatcggcggcctc
gggcacgtggccgtgcagtatgcgcgggcgatgggcctgcacgtcgcggccatcgacatt
tcccccgacaagctcgcgctggcgcggcaactgggcgcgcacctgacgatcgacgcgtcg
atcgacgaccccgcaacagtgatccagaaggaaatcggcggcgcgcacggcgtgctcgtc
acggccgtgtcgcgcagcgcgttcgcgcaggcgctcgggatggtccggcgcggcggcacg
gtggcgctcaacggtttgccgccgggcgatttcccgctgccgatcttctcgaccgtgctg
aacggcatcaccgtgcgcgggtcgatcgtcggcacgcggcgcgatctgcaggaatcgctc
gatttcgcggcggacggcctggtgcgcgcgcacatccaccgcgaccggctcggcaacatc
aacgacgtattcgcgaagctgcgggaagggaaggtcgacgggcgcatcgtgctgaccgac
atgcattga

DBGET integrated database retrieval system