KEGG   Burkholderia cenocepacia J2315: BCAM1570Help
Entry
BCAM1570          CDS       T00771                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00010  Glycolysis / Gluconeogenesis
bcj00071  Fatty acid degradation
bcj00350  Tyrosine metabolism
bcj00625  Chloroalkane and chloroalkene degradation
bcj00626  Naphthalene degradation
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAM1570 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    BCAM1570 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCAM1570 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCAM1570 (adhA)
   00626 Naphthalene degradation
    BCAM1570 (adhA)
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCAM1570 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: CAR55426
UniProt: B4EK33
Position
2:complement(1747253..1748281)
Genome map
AA seq 342 aa AA seqDB search
MTQTMKAAVVHAFGAPLRIEEVPIPAPGPGQILVNIKASGVCHTDLHAADGDWPVKPSLP
FIPGHEGVGIVAAVGAGVTHVREGDRVGVPWLYTACGHCEYCCTGWETLCHGQQNTGYSV
NGSYAEYVLADPDYVGQLPAQVAFDEIAPILCAGVTVYKGIRVTDTRPGQWLAISGIGGL
GHVAVQYARAMGLHVAAIDISPDKLALARQLGAHLTIDASIDDPATVIQKEIGGAHGVLV
TAVSRSAFAQALGMVRRGGTVALNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAADGLVRAHIHRDRLGNINDVFAKLREGKVDGRIVLTDMH
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccatgaaagcggccgtggtacacgcgttcggcgcgccgttgcgcatcgag
gaagtgccgattccggcaccggggcccggccagattctcgtcaacatcaaggcgtcgggt
gtttgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgtcgctgccg
ttcatcccgggccatgaaggcgtggggatcgtcgcggcggtcggcgcgggcgtcacgcac
gtgcgcgagggcgatcgcgtcggcgtgccgtggctctatacggcctgcggccattgcgag
tactgctgcacgggctgggaaacgctctgccacggtcagcagaacaccggctattcggtg
aacggcagctacgcggaatacgtgctggccgatcccgactacgtcggccagttgcccgcg
caggtcgcgttcgacgagatcgcgccgatcctgtgcgcgggcgtcacggtctacaagggc
attcgcgtcaccgacacgcgcccgggccagtggctcgcgatttccggcatcggcggcctc
gggcacgtggccgtgcagtatgcgcgggcgatgggcctgcacgtcgcggccatcgacatt
tcccccgacaagctcgcgctggcgcggcaactgggcgcgcacctgacgatcgacgcgtcg
atcgacgaccccgcaacagtgatccagaaggaaatcggcggcgcgcacggcgtgctcgtc
acggccgtgtcgcgcagcgcgttcgcgcaggcgctcgggatggtccggcgcggcggcacg
gtggcgctcaacggtttgccgccgggcgatttcccgctgccgatcttctcgaccgtgctg
aacggcatcaccgtgcgcgggtcgatcgtcggcacgcggcgcgatctgcaggaatcgctc
gatttcgcggcggacggcctggtgcgcgcgcacatccaccgcgaccggctcggcaacatc
aacgacgtattcgcgaagctgcgggaagggaaggtcgacgggcgcatcgtgctgaccgac
atgcattga

DBGET integrated database retrieval system