KEGG   Burkholderia cenocepacia J2315: BCAM1588Help
Entry
BCAM1588          CDS       T00771                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bcj01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bcj00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1772546..1774129)
Genome map
AA seq 527 aa AA seqDB search
MSQYQDDIKAVAGLKENHGSAWNAISPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADPSKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDAAKDAAAKAAIQQKIDNHVTHVVPIIA
DIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAI
RYAFLELGVDDGIIVARTDSLGAGLTKQIAVTNQPGDLGDQYNSFLDCEELSADQLGNGD
VVIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQNGADLLWIETEKPHIAQIGG
MVSEIRKVIPNAKLVYNNSPSFNWTLNFRQQAYDAMKAAGKDVSAYDRAQLMSVEYDETE
LAQLADEKIRTFQADASREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQ
RKEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatatcaagacgacatcaaggcagtggctggtttgaaggaaaaccacggcagc
gcgtggaatgccatcagccccgaatatgccgcccgcatgcgtgcccagaacaagttcaag
accggcctggacatcgcgaagtacacggcgaagatcatgcgcgccgacatggccgcgtac
gatgccgatccgtccaagtacacgcagtcgctgggttgctggcacggtttcatcggccag
cagaagatgatctccatcaagaagcacttcaacagcaccgaacgccgctacctgtatctg
tcgggctggatggtcgccgcgctgcgctcggagttcggcccgctgccggaccagtcgatg
cacgaaaagacttcggtcagcgcgctgatccgcgagctgtacacgttcctgcgccaggcc
gacgcccgtgagctgggtggcctgttccgcgagctggatgccgcgaaggacgctgccgcc
aaggccgcgatccagcaaaagatcgacaaccacgtcacgcacgtcgtgccgatcatcgcc
gacatcgacgccggcttcggcaacgcggaagcgacctacctgctggccaagcagttcatc
gaagcgggcgcgtgctgcatccagatcgaaaaccaggtgtcggacgagaagcagtgcggc
caccaggacggcaaggtcacggtgccgcacgaggacttcctcgcgaagatccgcgcgatc
cgctacgcattcctggagctgggcgtggacgacggcatcatcgtcgcgcgtaccgattcg
ctgggcgccggcctgaccaagcagatcgccgtgacgaaccagccgggcgacctgggcgat
caatacaactcgttcctcgattgcgaggaactgtcggccgaccagctgggcaacggtgac
gtcgtcatcaagcgcgacggcaagctgctgcgtccgaagcgcctgccgagcaacctgttc
cagttccgcgccggcacgggcgaagcgcgttgcgtgctcgactgcatcacgtcgctgcag
aacggcgccgacctgctgtggatcgaaaccgaaaaaccgcatatcgcacagatcggcggc
atggtcagcgagatccgcaaggtgatcccgaacgcgaagctggtgtacaacaacagcccg
tcgttcaactggacgctgaacttccgtcagcaggcgtacgacgcgatgaaggcagcgggc
aaggacgtgtcggcttacgaccgcgcgcagctgatgagcgtggaatacgacgagaccgaa
ctggcgcaactggccgacgagaagatccgtacgttccaggccgatgcatcgcgtgaagca
ggcatcttccatcacctgatcacgctgccgacgtaccacacggccgcgctgtcgaccgac
aacctggccaaggaatacttcggcgaccagggcatgctcggctacgtggccggcgtgcag
cgcaaggaaatccgtcagggcatcgcctgcgtgaagcaccagaacatgtccggttcggac
atcggtgacgatcacaaggaatacttcagcggcgaagcggcgctgaaggccgcgggcaag
gacaacacgatgaaccagttctga

DBGET integrated database retrieval system