KEGG   Burkholderia cenocepacia J2315: BCAM1614Help
Entry
BCAM1614          CDS       T00771                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCAM1614 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAM1614 (mhpF)
   00650 Butanoate metabolism
    BCAM1614 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAM1614 (mhpF)
   00622 Xylene degradation
    BCAM1614 (mhpF)
   00621 Dioxin degradation
    BCAM1614 (mhpF)
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BCAM1614 (mhpF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     BCAM1614 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1797221..1798120
Genome map
AA seq 299 aa AA seqDB search
MKKIKCALIGPGNIGTDLLYKLRRSPVLEPVWMVGVDPASDGLARAREFGLKTTDKGVDG
LLPHVVGDEIRIAFDATSAYVHRDNSDKLTALGVKMIDLTPAAIGPYCVPPVNLDAHLDS
AQTNVNMVTCGGQATIPMVYAVSRVQPVAYGEIVATVSSRSVGPGTRKNIDEFTRTTSGA
IEQVGGARKGKAIIVINPAEPPLIMRDTIHCLTDGPPDVDAITASVHAMVKEVQRYVPGY
TLKNGPVFDGNRVSVFMEVEGLGDYLPKYAGNLDIMTAAAAATAERFAEQMLAATAATA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcaaatgcgcattgatcgggccgggcaacatcggcaccgatctgttgtac
aagctgcgccgttcgccggtgctcgaacccgtgtggatggtcggcgtcgacccggcatcc
gacggcctcgcacgcgcgcgcgagttcggcctgaaaaccaccgacaagggggtcgacggg
ctgctgccgcacgtcgtcggcgacgagatccgcatcgcattcgacgcgacgtcggcatac
gtgcatcgcgacaattccgacaagctcaccgcgctcggcgtgaagatgatcgacctgacg
cccgcggcgatcgggccgtattgcgtgccgccggtgaacctcgacgcgcatctcgacagc
gcgcagacgaacgtgaacatggtgacctgcggcggccaggcgacgattccgatggtgtat
gcggtgtcgcgcgtacagccggtcgcgtacggcgagatcgtcgcgaccgtgtcgtcgcgc
tcggtcggccccggcacgcgcaagaacatcgacgagttcacgcgcacgacgtccggcgcg
atcgaacaggtcggcggcgcacgcaagggcaaggcgatcatcgtcatcaacccggccgag
ccgccgctgatcatgcgcgacacgatccactgcctgaccgacgggccgcccgacgtcgac
gcgatcaccgcgtccgtgcatgcgatggtcaaggaagtgcaacgctacgtgcccggctac
acgttgaagaacggcccggtgttcgacggcaatcgcgtgtcggtgttcatggaagtcgag
gggctcggcgactacctgccgaagtacgcgggcaacctcgacatcatgaccgccgccgcg
gccgccacggccgagcgtttcgccgaacagatgctggccgcgacggccgccaccgcttga

DBGET integrated database retrieval system