KEGG   Burkholderia cenocepacia J2315: BCAM2006Help
Entry
BCAM2006          CDS       T00771                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bcj00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bcj00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2221196..2222491
Genome map
AA seq 431 aa AA seqDB search
MTVPQQAFLRDAMRRLNMTREAFANRIGVSRRALDTWLLPDDSQESRGMPEIVERFVSEI
VERSAPDGENYTQSVDKQGLAKQFLFEGKPQLISVDQFSRDSVEALFRVADVMQPIARRH
KISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRV
MAGYVDALVIRHPEKGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKI
VDGAHIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIVDQIATNGHVVEQ
TTDLAAGLRGADVVYATRIQKERFTDESFEGYTPDFQINQALVDSVCKPDTLIMHPLPRD
SRPGANDLSVDLNRDPRLAIFRQTDNGIPVRMAIFAVLLGVENLVQHSMRDATWRPPAYL
GPEDAVFHGID
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttccccagcaagccttcctccgcgacgcgatgcgccgcctcaacatgacccgc
gaggcgttcgcgaatcgcatcggcgtcagccggcgcgcgctggatacctggctacttccc
gacgattcgcaggaatcgcgagggatgcccgagatcgtcgagcgcttcgtgtcggagatt
gtcgagcgctcggcgccggatggcgagaactatacgcaaagcgtagacaaacaagggctc
gcgaagcagttcctgttcgaaggcaagccgcaattgatctcggtcgaccagttctcgcgg
gattcggtcgaggcgctgttccgcgtggccgacgtcatgcagccgatcgcgcgacgccac
aagatttcgcgcgtgctcgaaggcgccgtgctcggcaacctgttcttcgaggccagcacg
cgtacacgcgtgtcgttcggcgcggccttctgccggctcggcggctcggtgtgcgacacg
acgggcttcacgttctcgtcgatggccaagggcgaatcgatctacgacacgagccgcgtg
atggccggctacgtcgacgcgctcgtgatccgccatcccgaaaaaggctcggtggccgaa
ttcgcgcgcgcgaccaacctgccggtgatcaacggcggcgacggccccggcgagcacccg
agccaggcgctgctcgacctctatacgatccagcgcgaattctcgcggctcggcaagatc
gtcgacggcgcgcacatcgcgctggtcggcgacctgaagtacggccgcaccgtgcactcg
ctcgtcaagctgctcgcgctgtaccgcgggctgaagttcacgctcgtatcgccgccgacg
ctcgagatgccggcgtacatcgtcgaccagatcgcgacgaacggccatgtggtcgagcag
acgaccgacctcgcggccgggctgcgcggagcggatgtcgtctacgcgacgcgaattcag
aaggagcgtttcaccgacgagtcgttcgaaggctacacgccggatttccagatcaaccag
gcgctcgtcgactcggtatgcaagccggacacgctgatcatgcacccgctgccgcgcgac
agccggcccggcgcgaacgacctgtcggtcgacctgaaccgcgacccgcgtctcgcgatc
ttccggcagaccgacaacggcattccggtgcggatggcgatcttcgcggtgctgctcggt
gtcgagaatctcgtccagcattcgatgcgcgacgcgacgtggcgtccgccggcgtacctc
ggcccggaagacgctgtgtttcacgggatcgattga

DBGET integrated database retrieval system