KEGG   Burkholderia cenocepacia J2315: BCAM2048Help
Entry
BCAM2048          CDS       T00771                                 

Gene name
bcscN
Definition
type III secretion ssytem protein
Orthology
K03224  
ATP synthase in type III secretion protein SctN [EC:3.6.3.14]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Bacterial secretion system
Module
Type III secretion system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    BCAM2048 (bcscN)
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     BCAM2048 (bcscN)
Secretion system [BR:bcj02044]
 Type III secretion system
  Type III protein secretion pathway protein [MD:M00332]
   BCAM2048 (bcscN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2279761..2281134)
Genome map
AA seq 457 aa AA seqDB search
MSAPLDDPPSFGDDDAPFDRGRLVGELDAGLAFFSPVSVQGRVNHAVGQILNATGIRARL
GEICELRTPNQPTLLAEVVGFSRQTTLLTPLGDVAGLSPETTVVPSGREHVFPVGEGLFG
RVLDGLGRPLDDRGPVTGAAWVSTQQDPPNPLARKMIDTPFPTGVRVIDGLMTLGIGQRV
GIFAPSGVGKSTLLGMIARGAQADVNVIALVGERGREVREFIEHSLSPEVRARSIVVVST
SDRPAMERVKSALVATAIAEHFRDAGKRVLLLVDSLTRFARAQREVGLASGEPPTRRSFP
PSTFAVLPRLLERAGQGAHGSITALYTVLVEGDEESDPIAEEVRSILDGHIVLSRKIALA
NRYPAIDVLASLSRVMPLVASRAHQHAAARVRELIAKYQEIELLVQIGEYREGSDRLGDL
ALRARDAIGAFCAQASDEDVRFDALLAKLTKLANDHV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgccgctcgacgatccgccgtcgttcggcgacgacgacgcgccgttcgatcgc
ggccgcctggtcggcgagctcgacgcggggctcgcgttcttctcgccggtctcggtgcag
ggccgcgtcaaccacgcggtcgggcagatcctgaacgcgacgggcatccgcgcgcggctc
ggcgagatctgcgagctgcgcacgccgaaccagccgacgctgctcgcggaggtggtcggc
ttctcgcggcagacgacgctgctcacgccgctcggcgacgtggccggcctgtcgccggag
acgaccgtcgtgccgtccgggcgcgaacatgtctttccggtgggcgaaggactgttcggc
cgcgtgctcgacgggctcggccggccgctcgacgatcgcgggccggtgacgggcgccgcg
tgggtgtcgacgcagcaggacccgccgaacccgctcgcgcgcaagatgatcgacacgccg
tttccgaccggcgtgcgcgtgatcgacgggctgatgacgctcggcatcgggcagcgcgtc
ggcatcttcgcgccgtccggcgtcggcaagagcacgctgctcgggatgatcgcgcgcggc
gcgcaggccgacgtgaacgtgatcgcgctggtcggcgagcgcggccgcgaggtgcgcgaa
ttcatcgagcacagcttgtcgccggaagtgcgcgcgcggtcgatcgtcgtcgtgtcgacg
tccgatcgccccgcgatggagcgcgtgaaatccgcgctggtcgcgaccgcgatcgccgag
cacttccgcgatgcgggcaagcgcgtgctgctgctggtcgattcgctgacgcgctttgcg
cgcgcgcagcgcgaggtcggcctcgcgagcggcgagccgccgacgcggcgcagcttcccg
ccgtcgacgttcgcggtgttgccgcgcctgctcgaacgcgcggggcagggggcgcacggg
tcgatcaccgcgctctacacggtgctcgtcgaaggcgacgaggaatcggacccgatcgcc
gaggaggtgcgctcgatcctcgacggccatatcgtgctgtcgcgcaagatcgcgctcgcg
aatcgctatccggcgatcgacgtgctcgcgagcctgtcgcgggtgatgccgctcgtcgcg
agccgcgcgcaccagcatgcggccgcgcgcgtgcgcgagttgatcgcgaagtaccaggag
atcgagctgctcgtgcagatcggcgagtatcgcgaaggcagcgaccggctcggcgatctc
gcgctgcgcgcgcgcgacgcgatcggcgcgttctgcgcgcaggcgtcggacgaggacgtg
cgcttcgacgcgctgctcgcgaaactgacgaagctggcgaacgatcatgtctga

DBGET integrated database retrieval system