KEGG   Burkholderia cenocepacia J2315: BCAM2122Help
Entry
BCAM2122          CDS       T00771                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00360  Phenylalanine metabolism
bcj00362  Benzoate degradation
bcj00620  Pyruvate metabolism
bcj00621  Dioxin degradation
bcj00622  Xylene degradation
bcj00650  Butanoate metabolism
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
bcj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAM2122
   00650 Butanoate metabolism
    BCAM2122
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BCAM2122
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAM2122
   00622 Xylene degradation
    BCAM2122
   00621 Dioxin degradation
    BCAM2122
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BCAM2122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored DapB_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CAR55980
UniProt: B4EFI8
Position
2:complement(2360785..2361747)
Genome map
AA seq 320 aa AA seqDB search
MNDRVKVAIIGPGNIGTDLMIKIMRNGRHLKMGAMVGVDPNSEGLARAARMDVATTAEGI
DGLLRLDVFKEIDIVFDATSAGAHGRHNELLQAHGVQVIDLTPAAIGPYVIPSINLEEEN
ATNMNMVTCGGQATIPIVAAVSRIAKVHYAEIVASISSRSAGPGTRANIDEFTETTRAAI
EKLGGAERGKAIIVLNPAEPPLIMRDTVFVLSENAEPAAIEASIAEMVSSVQEYVPGYRL
KQSVQFDAVPPDMPLNVPGIGPRHGLKTSVFLEVEGAAHYLPSYAGNLDIMTSAALACGD
MMARRRMAAGIARGFKETAR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacagggtgaaggtcgccatcatcggtcccggcaatatcggcaccgatctgatg
atcaagataatgcgaaacggcaggcatctgaaaatgggtgccatggttggcgtcgatccg
aattcggaagggttggcgcgtgcggcacgcatggatgtcgcgacgacggcagaaggaatc
gacggcttgctacggctggacgtattcaaggagatcgatatcgtcttcgatgcgacgtca
gcgggcgcgcacggacgtcacaatgaattgctgcaggcgcatggggttcaggtgattgac
ctcacgcctgccgcgatcgggccgtatgtgattccatcgatcaatctggaagaagaaaac
gcgacaaacatgaatatggtcacgtgcggcgggcaggccaccattccgatcgtcgccgct
gtttcacgcatcgccaaagtccactatgcggagatcgtcgcgtcgatctccagccggtcc
gccgggccgggaacgcgcgcgaatattgacgaattcaccgagacgacgcgagccgcgatt
gaaaagcttggcggcgccgagcgcggtaaggcgatcatcgttctcaatcccgcggagccg
ccgttgatcatgcgcgacaccgtattcgtgctgtcggaaaacgcggagccggcggctatc
gaggcgagtatcgccgaaatggtgagcagcgtgcaggaatacgttccgggctaccgcctg
aagcagtcggttcaattcgacgcggtgccgccggacatgccgctcaacgtgccgggcatc
gggccgcggcacggcttgaaaacctcggtatttctcgaagtggaaggcgcagcccactat
ttgccttcctatgccggcaacctcgacatcatgacgtcggcggcactcgcgtgcggagac
atgatggcccggcgccggatggccgccggcatcgctcgcggcttcaaggagacggcgcga
tga

DBGET integrated database retrieval system