KEGG   Burkholderia cenocepacia J2315: BCAM2176Help
Entry
BCAM2176          CDS       T00771                                 

Gene name
glsA
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bcj00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bcj00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bcj00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2433646..2434560
Genome map
AA seq 304 aa AA seqDB search
MNYQTTLERIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTLDGNVYTVGDAHERFS
IQSISKLFACTLAFQLLGDELWERVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLCRRFVKAETALVEFVRRLIGANDIDYDSRVALSELQHAERNRAMAHFMASFGNMQMP
PDTVIDAYCRQCAIEMNCVELASAALFLANGGVAPATGERIVDSSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDANGNSLAGTLALEWLTTYTG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaattaccagacgactctcgaacgcatccacaccgaactcgccccctggattggccag
ggccgggtggccgactacattcccgaactcgcaaaagtgcccgccgacaagttcgggatg
gcggtcgtgacgctcgacggaaacgtttacacggtcggcgatgcgcacgagcgcttctcg
atccagagcatctcgaagctgttcgcgtgcacgctcgcgttccagctgctgggcgacgaa
ctgtgggaacgggtcggccgcgagccgtccggcaccgcgttcaactcgctggtccagctc
gaaagcgagcgcggcaagccgcgcaatccgttcatcaatgcgggcgcgctggtcgtcacc
gacgtgctgtgccgccgcttcgtgaaggccgagacggcgctcgtcgagttcgtgcggcgg
ctgatcggcgcgaacgacatcgactacgactcgcgcgtcgcgctgtcggagttgcagcac
gcggagcgcaaccgcgcgatggcgcatttcatggcgagcttcggcaacatgcagatgccg
cccgataccgtgatcgacgcgtattgccgccagtgtgcgatcgagatgaactgcgtcgaa
ctcgccagcgccgcgctgttcctcgcgaacggcggggtcgcgccggcgaccggcgagcgg
atcgtcgattcgagttccgcgaagcggctgtcggcgctgatgctgacctgcggcacctac
gatgcggccggcgatttcgtgtatcgggtcgggttgccggcgaagagcggcgtggggggc
gggatcgtcgcggtgctgccgggggagatggcggtgtgcgtgtgggcgccggggctcgat
gcgaacgggaactcgttggcggggacgctggcgctggagtggttgacgacttatacggga
aggtcgattttttga

DBGET integrated database retrieval system