KEGG   Burkholderia cenocepacia J2315: BCAM2333Help
Entry
BCAM2333          CDS       T00771                                 

Gene name
fdhA
Definition
putative glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAM2333 (fdhA)
  Energy metabolism
   00680 Methane metabolism
    BCAM2333 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCAM2333 (fdhA)
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BCAM2333 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2620974..2622170)
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGQVEVQKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGRDVETLKLGDLVSVPFNVACGRCAMCKDTHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAERLAHARAMGFETVDLSKD
ASLGEQIEQILGVPEIDCAVDCVGFEAHGHGSSGHAEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAKDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILFDRLPIA
KIVNVEVISLDQAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttggaccgggccaggtcgaagtccagaaaatc
gattatccgaagatggtcgacccgagcggccgcgcgatcggccacggcgtgatcctgaaa
gtggtcagcacgaacatctgcggctccgaccagcacatggtgcgcggccggacgaccgcg
ccggtcggcctcgtgctcggtcacgagatcaccggcgaagtggtcgaagtgggccgcgac
gtcgagacgctgaagctcggcgatctcgtgtcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggacacgcatacgggcgtgtgcctgaacgtgaacccgtcgcgtgcc
ggcggcgcgtacggctacgtcgacatgggcggctggatcggcggccaggccgagtacgtg
ctcgtgccgtatgccgatttcaacctgctgaaattcccggatcgcgaccaggcgatggcg
aagatccgcgacctgacctgcctgtccgacattctgccgaccggttatcacggtgcggtg
agcgccggcgtgaaacccggttcgacggtctatatcgcgggcgcgggcccggtcgggatg
gcggcggccgcatcggcgcgcctgctcggcgcggccgtgacgatcgtcggcgacatgaac
gcggaacgtctcgcgcatgcacgggcgatggggttcgagacggtcgatctgtccaaggac
gcgtcgctcggcgagcagatcgagcagatcctcggcgtgcccgagatcgactgcgcggtc
gattgcgtcggcttcgaggcgcacggccacggctcgtcgggccatgcggaggaagcaccc
gcgacggtgctgaactcgctgatggaaatcacgcgcccggccggcgcgatcggcatcccg
ggcctgtacgtgacggacgatccgggcgcgaaggacaaggccgcgcagcacggcagcctg
agcatccgcttcggcctcggctgggcgaagtcgcattcgttcttcacgggccagacgccg
gtgctcaagtacaaccgcaacctgatgcaggcgatcctgttcgaccggctgccgatcgcg
aagatcgtcaacgtcgaagtgatctcgctcgatcaggcgccggaagggtacaagaagttc
gacggcggcgcgccgcgcaaattcgtcatcgacccgcacgggttgctggcggcgtga

DBGET integrated database retrieval system