KEGG   Burkholderia cenocepacia J2315: BCAM2482Help
Entry
BCAM2482          CDS       T00771                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bcj00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2809851..2810843
Genome map
AA seq 330 aa AA seqDB search
MIRQPHTGRDAPMNDHTHFQPLGGNEMPRCGGIATMMRLPHVASAEGLDACFVGVPFDLG
TSNRTGARFGPRQIRTESVLLRPYNMATRAAPFDSLQIADIGDVAINPYNLHDSIARIEA
AYDAILEHDCKPITLGGDHTIALPILRAIHRKHGKVALIHVDAHADVNDTMMGEKIAHGT
PFRRAVEEGLLHGDKVTQIGLRGTGYAAEDFDWCREQGFRVVQAEECWNKSLAPLMEEVR
ARIGDAPVYISFDIDGIDPAYAPGTGTPEIAGLTVPQALEIIRGAKGLNIVGCDLVEVAP
PYDPFGTTALLGANLAYELLCVLPGVAYRD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgatacggcaaccccacactggaagagacgcccccatgaacgaccacacccatttccag
ccgctcggcggcaatgaaatgccgcgctgcggcggcatcgcgacgatgatgcgcctgccg
cacgtggcgagcgccgaaggcctcgacgcctgtttcgtcggcgtgccgttcgacctcggc
acgtccaaccgcaccggcgcgcgcttcggcccgcgccagatccgcaccgaatccgtgctg
ctgcgcccgtacaacatggccacccgcgcagcacccttcgattcgctgcagatcgccgac
atcggcgacgtcgcgatcaatccgtacaacctgcacgattcgatcgcccgcatcgaggcc
gcgtacgacgcgattctcgagcacgactgcaagccgatcacgctcggcggcgaccatacg
atcgcgctgccgatcctgcgcgcgatccaccgcaagcacggcaaggttgcattgatccac
gtcgatgcacacgccgacgtgaacgatacgatgatgggtgaaaagatcgcgcacggcacg
ccgttccgtcgcgcggtcgaggaaggcctgctgcacggcgacaaggtcacgcagatcggc
ctgcgcggcaccggctacgcggccgaggatttcgactggtgccgcgagcagggcttccgc
gtcgtccaggccgaggaatgctggaacaagtcgctcgcgccgctgatggaagaagtgcgc
gcgcgcatcggcgacgcgcccgtctacatcagcttcgacatcgacggcatcgaccccgcc
tacgcgccgggcaccggcacgccggaaatcgcgggcctcacggtgccgcaggcgctcgag
atcatccgcggcgcgaaggggctgaacatcgtcggctgcgatctcgtcgaagtcgcgccg
ccgtacgacccgttcggcaccacagcgctgctcggcgcgaacctcgcgtacgagctgctg
tgcgtgctgccgggcgtcgcgtaccgcgactga

DBGET integrated database retrieval system