KEGG   Burkholderia cenocepacia J2315: BCAM2735Help
Entry
BCAM2735          CDS       T00771                                 

Definition
NAD dependent epimerase/dehydratase family protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bcj  Burkholderia cenocepacia J2315
Brite
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     BCAM2735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:3095436..3096443
Genome map
AA seq 335 aa AA seqDB search
MTDTSRDLVLVTGASGFVGSAVARIAQQKGYAVRVLVRPTSPRTNVADLDAEIVTGDMRD
EASMRAALRGVRYLLHVAADYRLWAPDPDEIERANLEGAVATMRAARAAGVERIVYTSSV
ATLKVTSAGDPSDENRPLTAEQAIGVYKRSKVLAERAVERMIADEGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAHGHFLALERGRIGERYILGGENL
PLQQMLADIAQMTGRKAPTIALPRWPLYPLAVGAEAVAKFTKKEPFVTVDGLRMSKNKMY
FTSAKAERELGYRARPYREGLRDALDWFGSAGYLK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacctcccgcgatctcgttctcgtcaccggcgcgtccggtttcgtcggctcg
gccgtcgcgcgcatcgcgcagcagaaaggctatgcggtgcgcgtgctggtgcgcccgacc
agcccgcgcacgaacgtcgcggatctcgacgccgagatcgtcaccggcgacatgcgcgac
gaggcgtcgatgcgcgccgcgctgcgcggcgtgcgctacctgctgcacgtggcggccgac
taccggctgtgggcgcccgaccccgacgagatcgagcgcgcgaacctcgaaggcgcggtc
gcgacgatgcgcgcggcccgcgcggcaggcgtcgagcggatcgtctacacgagcagcgtc
gcgacgctgaaggtgacgagcgccggcgatccgtccgacgagaaccggccgctcacggcc
gagcaggcgatcggcgtctacaagcgcagcaaggtgctcgcggagcgcgcggtcgaacgg
atgatcgccgacgaagggctgccggccgtgatcgtcaacccgtcgacgccgatcggcccg
cgcgacgtgaagccgacgccgaccggccgcatcatcgtcgaggccgcgctcggcaagatt
cccgcgttcgtcgatacggggctgaacctcgtgcacgtcgacgacgtcgcgcacggccac
ttcctcgccctcgagcgcggccggatcggcgagcgctacatcctcggcggcgagaacctg
ccgctgcagcagatgctcgcggacatcgcgcagatgacgggccgcaaggcgccgacgatc
gcgctgccgcgctggccgctgtacccgctcgcggtcggtgccgaagcggtcgcgaagttc
acgaagaaggagccgttcgtcaccgtcgacgggctgcggatgtcgaagaacaagatgtat
ttcacgtcggcgaaggccgagcgcgagctcggctaccgtgcgcgcccgtatcgcgaaggg
ctgcgcgatgcgctggactggttcggctcggcgggctacctcaagtaa

DBGET integrated database retrieval system