KEGG   Burkholderia cenocepacia J2315: BCAM2807Help
Entry
BCAM2807          CDS       T00771                                 

Gene name
bgaB
Definition
putative beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bcj00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:3175650..3177635
Genome map
AA seq 661 aa AA seqDB search
MRLGVCYYPEHWPESMWADDARRMKTLGIEQVRIAEFAWSRIEPSPGEYDWGWLDRAVDV
LGAAGLEIVMCTPTATPPKWLVDRHPDILAIGADGRPRAFGSRRHYDFSSPTYLEASRQI
CTAVAERYGRHPAVRYWQTDNELGCHQTVVSYSPAALVRFREWLKARYGTIDALNRAWGT
VFWSMEYRHFDEVDAPVGTVTEAHPSHRLDYRRFASDELARYHRMQVDVIRAHSPGRPVA
HNFMQLFTEFDHYEVARDLDIATWDSYPLGALEEQWFAPDVKARWLRTGHPDFASFNHDL
YRGMSKLPFWVMEQQPGPVNWAQWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLHTPDDKLDEGGREAQRVAREIATVHDAGADADGAVRAPVALVFDYEAKWLFEV
QPQGADFHYPRFAFEYYSALRALGLDVDIVSAHAPLDGYRVVVVPPLPIVPDDFASRLAA
SSAHVVFGPRTGSKTVDLQIPPALPPGPLASILPVRVWRVESLRPNLTERIDGALRDGSP
LAGAARHWRDFVELHNDTRSVVHARFADGHPACVSHGALHYWAALFDDATTMRLFADVAA
EAGLAPTPLPDGVRVSRRGGLTYVFNYGSTPHTIDAIPPSAFVFGAAQVGPQDVAVYRSR
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcggagtctgctactacccggaacactggccggaatcgatgtgggccgacgac
gcccgccggatgaaaacgctcggcatcgagcaagtgcggatcgccgaattcgcatggagc
cgcatcgagccgtcgccgggcgaatacgactggggctggctcgaccgtgcggtcgacgtg
ctcggcgcagccggcctcgagatcgtgatgtgcacgccgaccgcgacgccgccgaaatgg
ctggtcgaccgtcatcccgacatcctcgcgatcggcgcggacggccggccgcgcgcgttc
ggctcgcgccgccactacgatttctcgtcgccgacctatctcgaagcgtcgcgccagatc
tgcacggcggtcgccgagcgctacggccgccatccggccgtgcgctactggcagaccgac
aacgagctcggctgccaccagaccgtcgtcagctactcgccggccgcgctcgtgcgcttc
cgcgaatggctgaaggcgcgctacggcacgatcgacgcgctgaaccgtgcatggggcacc
gtgttctggagcatggagtatcgccatttcgacgaagtcgacgcgccggtgggcaccgtg
accgaagcccatccgtcgcatcgcctcgactaccgacgctttgcgtccgacgagctcgcg
cgctatcaccggatgcaggtcgacgtgatccgcgcacactcgccgggccggccggtcgcg
cacaacttcatgcagttgttcaccgagttcgatcactacgaggtcgcccgcgacctcgac
atcgcgacgtgggacagctacccgctcggcgcgctggaggagcaatggttcgcgcccgac
gtgaaggcgcgctggctgcgcaccggccatccggatttcgcgtcgttcaatcacgacctg
tatcgcggcatgtcgaagctgccgttctgggtgatggaacagcagccggggcccgtgaac
tgggcgcagtggaaccccgcgccgctgccgggcatggtgcggctgtggagctgggaggcg
ttcgcgcacggcgccggctgcgtgtcctacttccgctggcggcaggcgccgttcgcgcag
gaacagatgcacgcggggctgcacacgcccgacgacaagctcgacgaaggcggccgcgaa
gcgcagcgcgtcgcgcgcgagatcgcgaccgtgcacgacgccggcgcggacgcggacggc
gcggtgcgcgcgcccgttgcgctggtgttcgactacgaggcgaagtggctgttcgaagtg
cagccgcagggcgccgatttccactacccgcgtttcgcgttcgagtactactcggcgctg
cgcgcgctcggcctcgacgtcgacatcgtgtccgcgcacgcgccgctcgacggctaccgc
gtcgtcgtggtgccgccgctgccgatcgtgccggatgatttcgcgtcacggctcgccgca
tcgagcgcccatgtggtgttcgggccgcgcaccggctccaaaaccgtcgacctgcagatt
ccgccggcgctgccgcccggcccgctcgcgtcgatcctgccggtacgcgtgtggcgcgtc
gaatcgctgcggccgaacctgaccgaacggatcgacggcgcgctgcgcgacggctcgccg
ctcgcgggcgcggcgcgccactggcgcgacttcgtcgaactgcacaacgacacgcgcagc
gtcgtgcatgcgcgcttcgccgacggtcatcccgcctgcgtgtcgcatggcgcgctgcat
tactgggccgcgctgttcgacgacgcgaccaccatgcgcctgttcgccgatgtcgcggcc
gaagcgggcctcgcgccgacaccgctgcccgatggcgtacgcgtgagccgccgcggcggc
ctgacctacgtgttcaactacggcagcacgccgcacacgatcgacgcgataccgccgtcg
gcgttcgtgttcggcgccgcgcaggtcggaccgcaggacgtagccgtgtatcgaagccgt
tcgtaa

DBGET integrated database retrieval system