KEGG   Burkholderia cenocepacia J2315: BCAM2821Help
Entry
BCAM2821          CDS       T00771                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAM2821 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAM2821 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BCAM2821 (glcB)
Enzymes [BR:bcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BCAM2821 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:3191562..3193736
Genome map
AA seq 724 aa AA seqDB search
MIDQAGLQVAPALSQFIENEALPGTGIDKAAFWSGFSALVHDLAPRNRELLAERDRLQQE
LDAWHRAHPGPVRDHAAYRAFLERIGYLVPVPSNVAAATANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGAERTSAYNPTRGQRVIDYARNVLDTAAPLA
SGSHRDALRYRVQDGQLAVETAQGNVALAQPAQFVGYQGAADAPSAILLKHNGLHLEIQI
DASTPIGRADLANVKDVVLEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMQGTLVEEV
AKGGKTFTRRLNADREYTTPAGGTLSLHGRSLLFVRNVGHLMTNGAVLDRDGNEIPEGIL
DGVVTVLCALHDLKAKRNSRTGSIYIVKPKMHGPVEVAFADTLFARIEDLYGLPRNTLKM
GIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDEMHTAMEAGPMIRKGDMKSSAWI
QSYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQELEKTPYASERDALLEGLLTVPVVERAAWSEAEILSEVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGMITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPGYDQSTAFQAACALALQGTSQPSGYTEPLLHQFRLAFKAQ
QRGA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccaagcaggactgcaagtcgcgccagcgctgagccagttcattgaaaacgaa
gcgctgccgggcaccggcatcgacaaggccgcgttctggagcggtttctcggccctggtg
cacgacctcgcgccgcgcaaccgcgagctgctcgcggaacgcgaccgcctgcagcaggaa
ctcgacgcgtggcatcgcgcgcaccccggcccggttcgcgaccatgccgcgtatcgcgca
ttcctcgaacgaatcggctacctcgtgccggtcccgtcgaacgtcgcggcagccaccgcg
aacgtcgacagcgagatcgccacgcaggccggcccgcagctcgtcgtgccgctgtcgaac
gcacgctatgcgctgaacgccgcgaacgcgcgctggggcagcctgtacgacgcgctgtac
ggcaccgacgcactgcccgaagacggcggcgccgaacgcacgtcggcctacaacccgacg
cgcggccagcgcgtgatcgactacgcgcgcaacgtgctcgacaccgcggcgccgctcgcg
agcggctcgcaccgcgacgcgctgcgctaccgcgtgcaggacggccagctcgcggtcgaa
accgcgcagggcaacgtcgcgctcgcgcagcccgcgcagttcgtcggctaccagggcgcg
gccgatgcgccgtccgcgatcctgctgaagcacaacggcctgcacctcgagatccagatc
gacgcgtcgacgccgatcggccgcgccgatctcgcgaacgtgaaggacgtcgtgctcgaa
gccgcggtcagcacgatcatcgactgcgaggattcggtcgcggcggtcgacgccgacgac
aaggtccagctctaccgcaactggctcggcctgatgcagggcacgctggtcgaggaagtc
gcgaagggcggcaagaccttcacgcgccgcctgaacgcggatcgcgagtacacgacgccc
gccggcggcacgctgtcgctgcatggccgctcgctgctgttcgtgcgcaacgtcggccac
ctgatgaccaacggcgcggtgctcgaccgcgacggcaacgagattccggaagggattctc
gacggcgtcgtcacggtgctgtgcgcgctgcacgacctgaaggcgaagcgcaattcgcgc
acgggctcgatctacatcgtgaagccgaagatgcacggcccggtggaagtcgcgttcgcc
gacacgctgttcgcgcgcatcgaggatctgtacggcctgccgcgcaacacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcatgtatcgccgccgcc
gccgcgcgcgtggcgttcatcaacaccggcttcctcgaccgcaccggcgacgagatgcac
accgcgatggaagcgggcccgatgatccgcaagggcgacatgaagtcgtcggcgtggatc
cagtcgtacgagcgcaacaacgtgctcgcgggcctgtcggccggcctgcgcggccgcgcg
cagatcggcaagggcatgtgggcgatgccggacctgatgcatgcgatgctcgagcagaag
atcgcgcatccgcgcgccggcgcgaacaccgcatgggtgccgtcgccgaccgccgcgacg
ctgcacgcgctgcactaccacctcgtcgacgtgcaggccgtccagcaggaactcgagaag
acgccgtacgcgagcgagcgcgacgcactgctcgaagggttgctgaccgtgccggtcgtc
gagcgtgccgcgtggagcgaggcggaaatcctgagcgaggtcgagaacaacgcgcagggc
atcctcggctacgtcgtgcgctgggtcgaacagggcgtcggctgctcgaaggtgccggac
atccacgacgtcggcctgatggaagatcgcgcgacgctgcgcatttcgagccagcacatc
gcgaactggctgcgccacggcatgatcaccgaggcattcgtgctcgacgtgttcaagcgg
atggcgcgcgtcgtcgaccagcagaacgccggcgatccgaactatcgcccgatggcgccc
ggctacgaccagtcgaccgcgttccaggccgcgtgcgcgctcgcgctgcaaggtacgtcg
cagccgagcggttataccgagccgctgctgcatcagttccggctcgcgttcaaggcgcaa
cagcgcggcgcatga

DBGET integrated database retrieval system