KEGG   Burkholderia cenocepacia J2315: BCAS0075Help
Entry
BCAS0075          CDS       T00771                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00010  Glycolysis / Gluconeogenesis
bcj00071  Fatty acid degradation
bcj00350  Tyrosine metabolism
bcj00625  Chloroalkane and chloroalkene degradation
bcj00626  Naphthalene degradation
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAS0075
  Lipid metabolism
   00071 Fatty acid degradation
    BCAS0075
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCAS0075
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCAS0075
   00626 Naphthalene degradation
    BCAS0075
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCAS0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 NAD_binding_10 CoA_binding
Motif
Other DBs
NCBI-ProteinID: CAR57008
UniProt: B4EPJ2
Position
3:83802..84848
Genome map
AA seq 348 aa AA seqDB search
MTNQATYRAAVVKAPGQLELVERPIPAPAQGQVRIRVEACGVCHSDSATVEREAPDGAPP
RVPGHEVVGRIDALGEGVSGWRLGERVGVGFLAGEDRTCPSCRHGDVVNCQNPVITGMTT
DGGYAEIMLAEARGLVRVPDDLDAAEAAPLLCAGLTTFNALRNAGARAGDVVAIHGLGGL
GHLAVQFANKMGFHTVVIARGADKAALAAQLGAHRYIDGRTEDVAAALRALGGAKVVLGT
APTGSAMADTVAGLSARGKLIVVAVPGEPIAVNAVDLVFGGRSVVGALTGTVTDNEETLA
FARLQNVRPMIETFPLEQAQAAYDRMMRADVRFRAVLTMNYASNGASA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcaagcgacttatcgcgcggcggtagtcaaggcgcctgggcaactggaactg
gtcgagcggccgattcccgcgccggcgcaggggcaggtgcgcattcgcgtcgaagcctgc
ggcgtatgccattccgacagcgcaaccgtggagcgcgaagcgcctgacggcgcgccgccg
cgcgtaccggggcatgaagtcgtcggccgaatcgacgcgctcggcgaaggggtgtccggc
tggcggctcggcgaacgtgtcggcgtcggctttctcgccggtgaagatcgcacgtgcccg
tcgtgccggcacggcgatgtcgtgaactgccagaacccggtcatcaccgggatgacgacg
gacggcggctacgcggaaatcatgctggccgaagctcgcgggctcgtgcgcgtgccggac
gatctcgacgcggccgaggctgcgccgctgttgtgcgcggggctcaccacgttcaacgcg
ctgcgcaatgccggcgcgcgggccggcgacgtggtcgccatccatggcctcggcgggctc
ggccatctcgccgtgcagtttgcgaacaagatgggttttcacaccgtcgtgatcgcccgc
ggagccgacaaggccgcgcttgccgcgcagctcggcgcgcatcgctacatcgacgggcgg
accgaggacgtggccgctgcgctgcgcgcgctcggcggcgcgaaggtcgtgctcggcacg
gcgccgacgggctcggccatggccgacaccgtcgcgggcctgtccgcgcgcggcaagctg
atcgtcgttgccgtgccgggcgagccgatcgccgtgaatgcggtcgatctcgtgttcggc
ggccgctccgtggtcggcgcattgacgggaacggtgacggacaacgaagagacgctcgcg
ttcgcgcggctgcagaacgtgcggccgatgatcgaaacgtttccgctcgagcaggcgcag
gcggcatacgaccgcatgatgcgcgcggatgtccggttccgcgcggtactgaccatgaat
tacgcatccaacggagcttccgcatga

DBGET integrated database retrieval system