KEGG   Burkholderia cenocepacia J2315: BCAS0132Help
Entry
BCAS0132          CDS       T00771                                 

Definition
putative amidinohydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BCAS0132
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BCAS0132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(145281..146210)
Genome map
AA seq 309 aa AA seqDB search
MLCDSPKVPFLAQGCEPDTERVSATFAVLGAPYGVPYGPALLHCDASNAPDKVRERSFRY
GRQIGHYDFDLQGTLFGDTGATCVDCGNLPGTLDVARNAAAVTSAVASLLERGAIPVVLG
GDDSIPALCVRAFDAYGPLNVLQFDAHLDFRDEVNGERHGYSSPIRRIREMPFVRRIVQV
GLRGSGSARPSDVEDALRSGNVLVPADVVHDEGIEAVTRHLVDDAPWFVTVDIDGLDPSI
APGVVAPMPGGLTFHQTRGVLRHLCANTRLAGIDVVEYHPALDVREMTALTIVRLLTNVI
GTTARRIAR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgctttgcgattcaccgaaggtgccgtttcttgctcagggttgcgagccggatacggag
cgagtctccgccacgttcgccgtcctcggcgcgccgtacggcgtgccgtacggcccggcg
ctgctgcactgcgacgcgtccaacgcgcccgacaaggtgcgcgagcgcagcttccgctac
gggcgccagatcggacactatgacttcgacctgcaaggcacgctgttcggcgacacgggc
gcgacctgcgtcgattgcggcaacctgcccggcacgctggacgtcgcgcgcaacgcggcg
gccgtgacgtccgccgtcgcgtcgctgctcgagcgcggcgcgattccggtggtgctcggc
ggcgacgattcgattccggcgctgtgcgtgcgcgcgttcgacgcgtacggaccgctgaac
gtgctgcagttcgacgcgcatctcgacttccgcgacgaagtgaacggcgaacggcacggc
tattcgagcccgatccggcgcatccgcgagatgccgttcgtcaggcggatcgtccaggtc
ggcctgcgcggcagcggcagcgcgcgcccgagcgacgtggaggacgcgctgcgctcgggc
aacgtgctcgtgccggccgacgtcgtgcacgatgaaggcatcgaagccgtcacgcggcac
ctcgtggacgacgcgccgtggttcgtgaccgtcgacatcgacggcctcgacccgagcatc
gcgccgggcgtggtcgcgccgatgccgggcggcctgacgttccaccagacgcgcggcgta
ctgcggcacctgtgcgcgaacacgcgcctcgcgggaatcgacgtcgtcgaatatcacccg
gcgctcgatgtgcgcgagatgaccgcgctgacgatcgtgcggctgctgaccaacgtgatc
ggcaccaccgcgcgccgcatcgcgcggtaa

DBGET integrated database retrieval system