KEGG   Burkholderia cenocepacia J2315: BCAS0353Help
Entry
BCAS0353          CDS       T00771                                 

Definition
putative aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAS0353
   00052 Galactose metabolism
    BCAS0353
Enzymes [BR:bcj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BCAS0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(412079..413167)
Genome map
AA seq 362 aa AA seqDB search
MHIDTDSSYLTRGVARVHAEPWGTLPDGEPVRRYTLRNAHGMRVVVSDLGATVVSWLAPD
RTGRFADIVLAHDTPAEYLESGVYLGATIGRWANRIAGARFTLDGVDYLLDRNENGNLLH
GGANGFHRARWDVIDDGGGLTLRLDSPEGDAGFPGNVSVQVRYTLDDDGTLTIDYAGWTD
APTPLNLTNHSYFNLNGRAGSDVRGHLLHIDADAFLEVDDALIPTGTADVTGTAFDFRHS
APLGARLDWPHAQLARARGFDHCFVVGNGAREVRPVARVYDPESGRELIVSTDQRGLQLY
TGNYLDGVRVSGGTRCARHAALCVEAGGFPDQVNMDGLRDDVIVRPGTVYRQTTRYRVGV
HA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcgataccgattcctcctacctgacacgcggcgtcgcacgcgtgcacgccgag
ccgtggggcacgttgcccgacggcgagccggtgcggcgctatacgctgcgcaacgcgcac
gggatgcgtgtcgtcgtcagcgacctcggcgcgaccgtcgtgtcgtggctcgcgcccgat
cgcacgggacgcttcgccgatatcgtgctcgcgcacgacacgccggccgagtacctcgaa
tccggcgtctacctcggcgcgacgatcggccgatgggcaaaccggatcgccggcgcccgc
ttcacgctcgacggcgtcgactacctgctcgaccgcaacgagaacggcaacctgctgcac
ggcggcgcgaacgggtttcatcgcgcgcggtgggacgtgatcgacgacggcggcggcctg
acgctgcggctcgattcgccggaaggcgatgcgggattccccggcaacgtgagcgtccag
gtgcgctacacgctcgacgacgacggcacgctgacgatcgactatgcggggtggaccgat
gcgccgacgccgctgaacctgacgaatcacagctacttcaacctgaacggacgcgcgggc
agcgacgtgcgcggccatctgctgcacatcgacgccgacgcgttcctcgaagtggacgac
gcgctgatcccgaccggcacggccgacgtgacgggcacggcgttcgatttccggcacagc
gcgccgctcggcgcgcgcctcgactggccgcatgcgcaactcgcgcgggcgcgcggcttc
gatcattgcttcgtcgtcggcaacggcgcgcgcgaagtccggcccgtcgcacgcgtctac
gatccggaaagcggccgcgagttgatcgtgtcgaccgatcagcgcggcctgcagctctat
acgggcaactatctcgacggcgtgcgcgtgagcggcggcacgcgatgcgcacgccacgcg
gcgctgtgcgtcgaggccggcggctttccggaccaggtcaacatggacggcctgcgcgac
gacgtgatcgttcgtccgggcaccgtctatcgacagaccacgcggtatcgggtcggcgtt
cacgcgtag

DBGET integrated database retrieval system