KEGG   Burkholderia cenocepacia J2315: BCAS0353Help
Entry
BCAS0353          CDS       T00771                                 

Definition
putative aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcj00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bcj00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(412079..413167)
Genome map
AA seq 362 aa AA seqDB search
MHIDTDSSYLTRGVARVHAEPWGTLPDGEPVRRYTLRNAHGMRVVVSDLGATVVSWLAPD
RTGRFADIVLAHDTPAEYLESGVYLGATIGRWANRIAGARFTLDGVDYLLDRNENGNLLH
GGANGFHRARWDVIDDGGGLTLRLDSPEGDAGFPGNVSVQVRYTLDDDGTLTIDYAGWTD
APTPLNLTNHSYFNLNGRAGSDVRGHLLHIDADAFLEVDDALIPTGTADVTGTAFDFRHS
APLGARLDWPHAQLARARGFDHCFVVGNGAREVRPVARVYDPESGRELIVSTDQRGLQLY
TGNYLDGVRVSGGTRCARHAALCVEAGGFPDQVNMDGLRDDVIVRPGTVYRQTTRYRVGV
HA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcgataccgattcctcctacctgacacgcggcgtcgcacgcgtgcacgccgag
ccgtggggcacgttgcccgacggcgagccggtgcggcgctatacgctgcgcaacgcgcac
gggatgcgtgtcgtcgtcagcgacctcggcgcgaccgtcgtgtcgtggctcgcgcccgat
cgcacgggacgcttcgccgatatcgtgctcgcgcacgacacgccggccgagtacctcgaa
tccggcgtctacctcggcgcgacgatcggccgatgggcaaaccggatcgccggcgcccgc
ttcacgctcgacggcgtcgactacctgctcgaccgcaacgagaacggcaacctgctgcac
ggcggcgcgaacgggtttcatcgcgcgcggtgggacgtgatcgacgacggcggcggcctg
acgctgcggctcgattcgccggaaggcgatgcgggattccccggcaacgtgagcgtccag
gtgcgctacacgctcgacgacgacggcacgctgacgatcgactatgcggggtggaccgat
gcgccgacgccgctgaacctgacgaatcacagctacttcaacctgaacggacgcgcgggc
agcgacgtgcgcggccatctgctgcacatcgacgccgacgcgttcctcgaagtggacgac
gcgctgatcccgaccggcacggccgacgtgacgggcacggcgttcgatttccggcacagc
gcgccgctcggcgcgcgcctcgactggccgcatgcgcaactcgcgcgggcgcgcggcttc
gatcattgcttcgtcgtcggcaacggcgcgcgcgaagtccggcccgtcgcacgcgtctac
gatccggaaagcggccgcgagttgatcgtgtcgaccgatcagcgcggcctgcagctctat
acgggcaactatctcgacggcgtgcgcgtgagcggcggcacgcgatgcgcacgccacgcg
gcgctgtgcgtcgaggccggcggctttccggaccaggtcaacatggacggcctgcgcgac
gacgtgatcgttcgtccgggcaccgtctatcgacagaccacgcggtatcgggtcggcgtt
cacgcgtag

DBGET integrated database retrieval system