KEGG   Burkholderia cenocepacia J2315: BCAS0462Help
Entry
BCAS0462          CDS       T00771                                 

Definition
putative alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BCAS0462
  Lipid metabolism
   00561 Glycerolipid metabolism
    BCAS0462
   00600 Sphingolipid metabolism
    BCAS0462
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BCAS0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(527975..530110)
Genome map
AA seq 711 aa AA seqDB search
MTTRRAFVQWLAAGAASPILVGVGVRDARGGEPSRVALRDDRLVIEFDPAMRSRLAVRRG
GGTRALTRFDASETLEQLIGPAPAPTSDGPAPDTRPVRTIDRFALVDAAHADVSTAFGAG
RQLRLVGRSAHGFEKTVRITLLDARPGVALLDTQFRNVGTQPTDVRAWNVAAHRLLPAAA
GAGGYWTYSGASHADRRDWVQPVKAGFDQRNFMGMNASDYGGGTPVVDVWRRGQGIALGH
LDIVPRLVSLPVKAVRDEVSLGLRGEQTVTLAPGATLDTPTAFVMLHDGDYFVALDTYRQ
MMGAQGFHAPRPPASAYEPIWCAWGYERQFSLDYVRATLPKVQELGFKWAVLDDGWQRRT
GDWVPDRAKFPAGDADMKALVDDIHARGQKARLWIAPLAVAPGSDELHDHTDMLLLDADG
APQAITWWNSFYLCPAYEKTQAHIAALMKKVIGEWGFDGVKIDGQHLNGVAPCYNPAHRH
ARPEDSVEHLADFYRVFHDAAHAIKPDAVVEVCPCGTAYAFHNMRYIDQAPASDPLSSWQ
VRHKGKTLKALMGASSAYAGDHVELSDGGRDFASAVGVGAVISTKFTWPVDPKPKDSFLL
TPEHEQAWRHWVEVYNAHRLAEGRYRGELYDIAFDKPEAHVVEKDGVLHYAFYAERWSGP
VALRGLQPGRSYRIVDYANGNREVGRIAPGHDAIALRFEHAALLRAEPLDA
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccggcgcgcgttcgtgcagtggctggccgccggcgcggcgagcccgattctg
gtcggcgtcggcgtgcgcgatgcccgcggcggcgagccgtcgcgcgtcgcgctgcgtgac
gaccggctcgtgatcgagttcgatccggcgatgcgcagccggctggccgtgcgtcgcggc
ggcggcacgcgtgcgctgacccgcttcgatgcgagcgagacgctcgagcaactgatcggc
ccggcgccggcgccgacctcggacggccccgcgcccgacacgcggccggtgcgcacgatc
gatcgcttcgcgctcgtcgacgccgcgcatgcggacgtctccaccgccttcggcgcgggg
cggcaactgcggctggtgggccggtcggcgcacggcttcgagaagacggtgcgcatcacg
ttgctcgacgcgcggccgggcgtcgcgctgctcgacacgcagttccgcaacgtcggcacg
cagccgaccgacgtccgcgcatggaacgtcgccgcgcaccggctgctgccggccgcggcc
ggcgcgggcggctactggacctattcgggcgcgagccacgcggaccggcgcgactgggtg
cagccggtcaaggccggcttcgatcagcgcaatttcatgggcatgaacgcgtcggactat
ggcggcggcacgccggtcgtcgacgtgtggcggcgcggccagggcatcgcgctcggtcac
ctcgacatcgtgccgcgcctcgtatcgctgccggtgaaggcggtgcgcgacgaagtctcg
ctcggcctgcgcggcgagcagacggtcacgctcgcgccgggcgcgacgctcgatacgccg
accgccttcgtgatgctgcacgacggcgactatttcgtcgcgctcgatacgtaccggcag
atgatgggcgcgcagggtttccatgcgccgcggccgccggcgagcgcgtacgagccgatc
tggtgcgcgtggggctacgagcgtcagttcagcctcgactacgtgcgcgcgacgctgccg
aaggtgcaggaactcggcttcaagtgggcggtgctcgacgacggctggcagcggcgcacc
ggcgactgggtgcccgaccgcgcgaaattcccggccggcgacgcggacatgaaggcgctc
gtcgacgacatccatgcgcgcggccagaaggcgcggctgtggatcgcgccgctcgcggtc
gcgccgggcagcgacgaactgcacgaccacaccgacatgctgctgctcgacgcggacggc
gcaccgcaggcgatcacctggtggaacagcttctatctgtgcccggcctacgagaagacg
caggcgcacatcgccgcactgatgaagaaggtgatcggcgagtggggcttcgacggcgtg
aagatcgacggccagcacctgaacggcgtcgcgccgtgctacaaccccgcgcaccggcat
gcgcggccggaggattcggtcgagcacctcgccgatttctaccgcgtgttccatgacgcc
gcgcatgcgatcaagccggatgcggtcgtcgaagtgtgcccgtgcggcaccgcgtacgcg
ttccacaacatgcgctacatcgaccaggcgccggcgtccgatccgctgtcgagctggcag
gtgcgccacaagggcaagacgctgaaggcgctgatgggcgcatcgtccgcgtacgcgggc
gatcacgtcgaactgagcgacggcggccgcgatttcgcgtcggcggtgggcgtcggcgcg
gtgatctcgacgaagttcacgtggcccgtcgatccgaaaccgaaggactcgttcctgctg
acgcccgagcacgagcaggcatggcggcactgggtcgaggtctacaacgcgcaccggctc
gccgagggccgctatcgcggcgagctgtacgacatcgcgttcgacaagcccgaggctcac
gtcgtggaaaaggacggcgtgctgcattacgcgttctacgccgagcgctggagcggcccg
gtcgcgctgcgcggcctgcagcccggccggtcataccggatcgtcgattacgcgaacggc
aatcgcgaggtcggccgcatcgcgccggggcacgacgcgatcgcattgcgcttcgagcat
gcggcgctgctgcgcgccgagccgctcgacgcgtga

DBGET integrated database retrieval system