KEGG   Burkholderia cenocepacia J2315: BCAS0594Help
Entry
BCAS0594          CDS       T00771                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCAS0594
Enzymes [BR:bcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BCAS0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:651239..652165
Genome map
AA seq 308 aa AA seqDB search
METIAVIGSNMVDLVTYVARMPARGETLEAPNFELGCGGKGANQAVAAARLGARVVMVTK
VGDDVFADNTIRNFEREGIDTTHVRKVAGVPSGVAPIFVEPDSSNSILIVKGANRHLRPA
DIDAAAPMLAECALIVLQLEIELDTVYHAIEFGARHGIPVLLNPAPAVADLDFERIRSVE
FFVPNETELAIVSGMPVDSRESATRAAEALVARGLKHVLVTLGSNGSLLVSRDGVRHVPG
VPVDARDTTGAGDAYIGCFARCYAASRDAIDAMRYASAYAAHSVTGLGTQKSYADAATFE
RFLRDAGF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggagacaatcgccgtcatcggcagcaacatggtcgacctcgtgacctatgtcgcgcgc
atgcccgcccggggcgagacgctggaggccccgaacttcgagctcggctgcggcggcaag
ggcgcgaaccaggccgtcgcggccgcgcgcctcggcgcgcgcgtcgtgatggtcacgaaa
gtcggcgacgacgtgttcgccgacaacacgatccgcaacttcgagcgcgaaggcatcgac
accacgcacgtgcgcaaggtcgccggcgtgccgagcggcgtcgcgccgatcttcgtcgaa
cccgattcgagcaacagcatcctgatcgtcaagggcgcgaaccgccacctgcggccggcc
gacatcgacgcggccgcgccgatgctcgccgaatgcgcgctgatcgtgctgcagctcgag
atcgagctcgacaccgtctatcacgcgatcgaattcggcgcgcggcacggcattccggtg
ctgctgaatcccgcaccggcggtcgccgacctcgatttcgaacgcatccgttccgtcgaa
ttcttcgtgccgaacgaaaccgagctcgcgatcgtgtcgggtatgccggtcgattcgcgc
gaaagtgcgacccgcgccgccgaagcgctggtcgcgcgcgggctcaagcacgtgctcgtc
acgctcggtagcaacggttcgctgctggtgtcgcgcgacggcgtgcggcacgtgccgggc
gtgccggtcgacgcgcgcgacacgacgggggcgggcgatgcctatatcggttgcttcgca
cgctgctatgcggcgtcgcgcgacgcgatcgatgcgatgcgttacgcatccgcgtacgcc
gcgcattcggtcacgggcctcggcacgcaaaagtcgtacgccgacgccgcgacgttcgaa
cgctttctccgcgacgccggcttctga

DBGET integrated database retrieval system