KEGG   Burkholderia cenocepacia J2315: pBCA043Help
Entry
pBCA043           CDS       T00771                                 

Definition
thiol:disulfide interchange protein DsbC precursor
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bcj  Burkholderia cenocepacia J2315
Brite
Enzymes [BR:bcj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     pBCA043
Secretion system [BR:bcj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   pBCA043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pBCJ2315:complement(47598..48392)
Genome map
AA seq 264 aa AA seqDB search
MNNRLSRGRVRLLVAALATTLTYTSIAYAADDTAAAQQVSDHLAATYPKTPFRDVKPAPL
PGLYEVSMGETVAYTDSTGRYFLFGHLYDMQDQVDITEQRKAQGYKTRFPAAVLNHAIKT
VHGNGQRVLAVFSDPDCPYCHQLEQQLAMVDNVTIYTFLYPLESLHPDAMTKSIRIQCSA
DPAKAWREWMTESRLPPLGSCHHPINDNIVLGSRLGVTGTPTIIAEDGRMLPGAVSAAQL
SAWLDAGTSAASSNASAQPQGAFK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccgcctttcgcgcggtcgcgtccggctgctcgtcgccgcgctcgctacgacc
cttacctatacctcgatcgcttacgccgccgacgatacggcagccgcccagcaggtctcg
gaccacctggcggcgacctatccgaagacaccgtttcgcgacgtcaagccggccccactg
cccggcctgtacgaggtgtcgatgggcgagacggtggcgtacacggacagcactggccgc
tacttcctgttcgggcacctgtacgacatgcaggaccaggtcgacatcaccgaacagcgc
aaggctcaggggtacaagacccgcttccccgcggcggtcctgaaccacgcaatcaagacc
gttcacggtaacggacagcgcgtcctcgctgtgttctccgatcccgactgcccgtattgc
caccagctggagcagcagctcgccatggtcgacaacgtgacgatctacacgttcctctat
ccgctcgaatcgcttcatccggacgccatgacgaagtcgattcgcatccagtgctcggca
gatccagcgaaagcgtggcgggagtggatgacggagagccggcttccgccgctcggctcc
tgccaccacccgatcaacgacaacatcgtgctcggctcccgactcggcgtcaccggcacg
ccaacgatcatcgccgaagacggtcggatgctgcccggcgcagtgtcggcggcgcagctc
agcgcgtggctcgatgccggcacaagtgccgcctcgtcgaacgcctcggctcagccgcaa
ggagccttcaaatga

DBGET integrated database retrieval system