KEGG   Bacillus coagulans 2-6: BCO26_0030Help
Entry
BCO26_0030        CDS       T01527                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bck  Bacillus coagulans 2-6
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCO26_0030
Enzymes [BR:bck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BCO26_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31775..32554
Genome map
AA seq 259 aa AA seqDB search
MVMTTIDLADHIELSERHDQEIKIVSQNRFVPDDERNLAYQAARLLKTRCSVRQGVEIAI
DKVIPVAAGLAGGSSDAAATLRGLNTLWDLGLSLDELATLGAEIGSDVSFCVYGGTALAK
GRGENITKLPAPPNCWVILAKPSIGVSTAEIYRQLDLNEVVHPDIPGMISALCARDYAGI
CKHAGNVLESVTLKAYPQVAQIKKQMQRFGADLVLMSGSGPTVFGLVRHDSRLQRIYNGL
RGFCGQVFAVRMIGEREQF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgacaaccattgaccttgcagatcatatcgagctctcggagcggcacgatcag
gagattaaaattgtgtcgcaaaaccggtttgtgccggatgatgagagaaatttggcgtac
caggctgcaaggcttctgaaaacgcggtgtagcgtcaggcagggggtcgaaattgcgatt
gacaaagtcattccggtggctgccgggctggcggggggcagcagtgatgcggcagctacc
ctccgcggcctgaatacgctctgggatctcggcctttccttagatgagcttgcaacactc
ggtgccgaaatcgggtcggatgtctcgttttgcgtatacggcggcactgcgctcgcaaaa
ggaaggggagaaaatattacaaaactgccggcaccgccaaactgctgggtcattttggcg
aaaccgtccatcggcgtgtcaacggcagaaatttaccgccaactggacttaaatgaagtg
gtgcatccggatattcccggcatgatcagcgccctgtgcgcccgtgattatgccggcata
tgcaagcatgcgggaaatgtgctggaaagcgtcacattaaaggcatacccgcaagtggcg
caaatcaaaaaacaaatgcagcgcttcggggcggatctcgtcttaatgagcggaagcggc
ccgacagtattcgggcttgtccggcatgattcgcggctgcagcggatttataacggcctc
cggggattctgcggccaggtatttgctgtcaggatgattggagaacgcgaacaattttaa

DBGET integrated database retrieval system