KEGG   Bacillus coagulans 2-6: BCO26_0062Help
Entry
BCO26_0062        CDS       T01527                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bck  Bacillus coagulans 2-6
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bck00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64451..65287
Genome map
AA seq 278 aa AA seqDB search
MKCGPFTFDFTRKTYVMGILNVTPDSFSDGGNFFQPEKAVEHAYQMVQDGADLLDIGGES
TRPGHQPISAEEELDRILPVIHSVAGKVQAPLSVDTYKARTAEEAIKAGAHIINDVWGAK
RDPEIADVAAQYDVPIILMHNRENPQYEHFMRDCLNDLYESITIAKKAGVEDRQIILDPG
IGFAKGFQEDMEMMRNLDKLVGLGYPVLLAASRKRIIGSVLGLPTGERMEGTGAVCCFGI
MKGCHMVRVHDVKPVSRMVKMMDALVGKGEQDGQNLYS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtgtggtccgtttacgttcgactttacccgaaaaacctatgtgatgggcatatta
aatgtaacgcccgactctttttcggacggagggaatttttttcagcctgaaaaagcggtg
gaacatgcgtatcagatggtacaggacggtgccgatctgctcgatattggcggagagtcg
acaaggccggggcatcagccgatatcagcggaggaagaactggacagaatcctgccggtc
attcattctgtggcaggaaaagtccaggcgccgctttctgttgatacgtataaagcgaga
actgcggaagaagcaataaaagcgggcgcacatatcatcaatgatgtatggggggcaaaa
cgggatccggaaatcgccgatgtagccgcacagtacgatgttccgattattttaatgcat
aaccgcgaaaacccgcaatatgaacattttatgcgggactgtttgaacgatctgtatgaa
agcattacgattgcaaaaaaagcaggtgtcgaagaccggcaaatcatcctcgatccgggt
atcgggtttgcgaaaggttttcaggaagatatggaaatgatgcgaaaccttgacaaactt
gttggactcggctatcccgtcctgcttgctgcttcaagaaagcgcataatcggaagcgtg
ctcgggctgccgactggcgaaagaatggaaggcaccggggcggtatgctgttttggcatc
atgaaaggctgccatatggtccgtgtccacgatgtaaaacccgtaagcagaatggtgaaa
atgatggacgctctcgtcggaaaaggggaacaggatggacaaaatttatattcatga

DBGET integrated database retrieval system