KEGG   Bacillus coagulans 2-6: BCO26_0064Help
Entry
BCO26_0064        CDS       T01527                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bck  Bacillus coagulans 2-6
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCO26_0064
Enzymes [BR:bck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BCO26_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
65626..66144
Genome map
AA seq 172 aa AA seqDB search
MDNLAYLALGSNIEPRFDYLQHAVRLLGNNPGIKVCKASSIYETEPVGYTDQGQFLNMAV
KIETGLSPFGLLAACLEIEKKLRRKRKIHWGPRTIDLDILLYNQENMKTENLTIPHPRMH
ERAFVLVPLTELDNALCDPVTKIPYAELLKKCADKEGVRLWKQITGDTAFLP
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggataatctcgcttatttggcactcggatccaatattgaaccgcgatttgattatctt
cagcacgccgtccggttgcttggaaacaacccgggcataaaggtttgcaaagcttcatcc
atttatgaaaccgaacctgtcgggtacacagaccagggacagtttttaaacatggctgtc
aaaattgaaacggggttatccccttttggcctgctcgctgcctgccttgagattgaaaaa
aagttacggagaaaaaggaaaattcattgggggccgcggaccatagaccttgacattttg
ttgtataatcaggaaaatatgaaaacagagaatcttaccattccgcacccgcgcatgcat
gaacgggcatttgttttggttcccctcacggaattggacaatgcactttgcgaccctgta
accaaaatcccgtatgcggagctgctgaaaaaatgcgcagacaaagaaggtgtccggctg
tggaaacagatcacaggggatactgctttcttgccataa

DBGET integrated database retrieval system