KEGG   Bacillus coagulans 2-6: BCO26_0171Help
Entry
BCO26_0171        CDS       T01527                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bck  Bacillus coagulans 2-6
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bck01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bck00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
178728..179627
Genome map
AA seq 299 aa AA seqDB search
MEKHIAIMGVPMDLGQRYKGVDLGPQAIRYAGVKEGLEKLGCAVTDLGNIEIGRAEQLPD
DEVNARNLKTIAKASQFIAEHTDEIVKSNRFPLIFGGDHSIAIGTIAGISKHYRNLGVIW
FDAHADMNTPETSPSGNVHGMPLAASLGYGHASLTGVYGYIPKLKAEHVVLIGQRDLDEG
EKDFIRNLGIKIYTMAEIDRIGMESVMAASINYLKERTDGIHLSLDLDALDPQEAPGVGT
PVYGGLHFRESRLAMEILHDANAVVSADVVEVNPILDSRNQTAEKAVRLIETLFGKKLL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggagaaacatattgcaataatgggggttccaatggatcttgggcagcggtataaaggg
gtggatctaggcccgcaggcgatccggtatgcaggtgtgaaagaaggactcgagaaactc
ggctgcgcggttaccgatttgggcaatattgaaattggcagggcggagcagctccctgat
gacgaagtcaatgcaagaaatttaaaaacgattgcaaaagcgagccagttcattgcagag
catacagatgaaattgtaaaaagcaaccgattcccgcttatttttggcggcgaccacagc
attgccattgggacaattgccggcatcagcaaacattacagaaatctcggcgtcatttgg
tttgatgcgcatgcggatatgaatactcctgagacaagcccttccggaaatgtccacggc
atgccgcttgccgccagcctcgggtacgggcatgcttctttaacgggcgtttacggctat
attccgaaactgaaagcggagcatgttgtcctgatcgggcagcgggatttggacgaaggg
gaaaaggatttcatccgcaacctgggcattaaaatttacacgatggctgaaatcgaccgg
attgggatggagagcgtcatggcagcaagcattaactatttaaaagaaagaacggacggc
attcatttgtcgctcgatttagatgcgctcgatccgcaagaagccccgggtgtgggaacg
cctgtatacggcgggcttcatttccgcgaaagccggctcgccatggagatactgcacgat
gcaaatgcagttgtttcagctgatgttgttgaagtaaacccgattcttgacagccgcaat
caaacggcagaaaaagctgtccgcctgattgaaacattgttcgggaaaaaacttctttaa

DBGET integrated database retrieval system