KEGG   Bacillus coagulans 2-6: BCO26_0385Help
Entry
BCO26_0385        CDS       T01527                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bck  Bacillus coagulans 2-6
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bck00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
426925..427314
Genome map
AA seq 129 aa AA seqDB search
MACYHENESIGCVLHAHPKESFVFATLGMDMPNLTEATQKLGKIPTLEYRPATTVELAET
VRKHIISLGEKVTPAAMLLNRHGILITDETLHKAYDMLERIEYNAYVASKALVFEKLGIA
AIPDEVSAH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcctgttatcatgagaatgaatcgatcggctgtgtgctccatgcccatccaaaggaa
tctttcgtttttgcgactttgggaatggatatgccgaatttaactgaggctacacaaaag
ctcggaaaaatcccaacgttggaataccgcccggcaacaacagtagaactggcagaaact
gtccgaaagcacattatctcgttaggggaaaaagtaacaccggcagccatgctgctcaat
aggcatggtatcctgattacagatgaaaccctgcacaaagcctatgatatgcttgagaga
attgagtataacgcatatgttgcaagcaaagcccttgtctttgaaaaattgggcatcgcc
gcaatccctgatgaggtctctgctcattaa

DBGET integrated database retrieval system