KEGG   Bacillus coagulans 2-6: BCO26_0557Help
Entry
BCO26_0557        CDS       T01527                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00260  Glycine, serine and threonine metabolism
bck00750  Vitamin B6 metabolism
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01230  Biosynthesis of amino acids
Module
bck_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCO26_0557
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCO26_0557
Enzymes [BR:bck01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCO26_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEH52616
UniProt: F7Z2H8
Position
complement(608053..609117)
Genome map
AA seq 354 aa AA seqDB search
MNQWPGLLKQYKSFLPVTDKTPELTLFEGNTPLIPFARLSEKLGVELYGKFEGLNPTGSF
KDRGMVMAVAKAIESGSRSVICASTGNTSASAAAYAAKAGIRAIIVIPSGKIALGKLAQA
VMYGAEIVEIDGNFDQALKIVRKVSETSPVTLVNSVNPYRLEGQKTAAFEICEQLGSAPD
VLAIPVGNAGNISAYWKGFKEFNEKFETGLPEMHGFEAEGAAAIVRDRVIENPETVATAI
RIGNPASWKLAVNARDESGGVIDSVSDPEILDAFRLLARNEGTFAEPGSCASIAGVIKQV
KTGQIKKGSKVVAVLTGNGLKDPQTAMSQVEVRPAVLPATEEAVTDYLSNVIHV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatggccaggattactcaagcagtacaaatcatttttacccgtcacagacaaa
acaccagaattgacattatttgaaggcaatacgccgcttatcccgtttgcccgcttatcg
gaaaaactcggcgtggaattgtacggaaaatttgaagggttgaacccgaccggctctttt
aaagaccgcggcatggtgatggcggttgcgaaagcgatcgaaagcggcagcaggtccgtt
atctgcgcctccaccggcaacacatccgcttctgcggccgcctatgctgcaaaagccggg
atccgggcgatcatcgtgattccgagcggaaaaatcgcgcttggcaaactggcgcaggcc
gttatgtacggcgctgaaatcgtggaaattgacggcaattttgaccaggcgcttaaaatc
gtcaggaaagtaagcgaaacttcgcctgtcacacttgtaaactcagttaacccttaccgg
ctggaaggccaaaaaacggcagctttcgagatttgtgagcagctgggttcagcacctgat
gtccttgccatcccggtcggcaatgccggaaacatcagcgcgtattggaaaggattcaaa
gagttcaatgagaaatttgaaaccggcctgccggaaatgcacggctttgaagcggaaggc
gcggctgccatcgtccgggaccgggtgatcgaaaaccctgaaacggtcgccaccgcgatc
cggatcggcaacccggcaagctggaaactggccgtcaatgcccgcgatgaatcaggcggc
gtgatcgactcggtgtcagacccagaaattcttgatgcgttccggctgctcgcccgcaac
gaagggacgttcgccgagccgggttcatgtgcgtccatcgccggtgtcatcaagcaggtc
aaaacgggacagatcaaaaaagggagcaaagtggttgctgtcctgaccggaaacgggctt
aaagacccgcaaaccgccatgtcccaagtcgaagtccggcctgccgtgctgccggcaacg
gaagaagctgtgacagattatctttcaaatgtgatccatgtatga

DBGET integrated database retrieval system