KEGG   Bacillus coagulans 2-6: BCO26_0562Help
Entry
BCO26_0562        CDS       T01527                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bck  Bacillus coagulans 2-6
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCO26_0562 (gtaB)
   00052 Galactose metabolism
    BCO26_0562 (gtaB)
   00500 Starch and sucrose metabolism
    BCO26_0562 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BCO26_0562 (gtaB)
Enzymes [BR:bck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCO26_0562 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
613708..614595
Genome map
AA seq 295 aa AA seqDB search
MMQKIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIDSGIEDIIIVTGK
GKRAIEDHFDHAFELEDNLIAKKKFDLLEKVRQPAEVDIHYIRQKEPKGLGHAIWCARKF
IGNEPFAVLLGDDIIQAEPPCLKQMIDVYEQVHSSVIAVMEVAREETNRYGIIDPLDQKG
RIYDVKGFVEKPKVEEAPSNVAIIGRYILTPEIFDFLSLQKTGSGGEIQLTDAIEQLNEI
QKVYAYAYEGKRYDVGEKFGFIKSTIEMALSREDLRDDLLRYLEDLQWRIQNHQI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaaaatcaagaaggcgattatcccggcagcggggcttggaacacgtttcctg
ccggcgacgaaggcaatgccgaaagaaatgcttccgattgtcgataagccgacaatccaa
tatattgtggaagaggccattgattccggcattgaagatatcatcatcgtaaccgggaaa
gggaaacgggcgattgaagaccattttgaccatgcatttgagcttgaggacaatttgatc
gcaaagaaaaaatttgatctgcttgaaaaagtgcgccagcctgcagaagtggatatccat
tatatccggcaaaaggaaccaaaaggattgggccacgcgatttggtgtgcgcgcaaattt
atcggaaatgaaccgtttgccgtgctccttggagatgacatcatccaggctgaaccgcct
tgcctgaaacaaatgatcgatgtttatgaacaggtccattccagcgtgattgccgtcatg
gaagtcgcgcgcgaggaaacaaaccgttacgggattattgacccgctcgatcaaaaagga
agaatttatgatgtgaaaggctttgtagaaaagccgaaagtggaggaagcgccgtcaaat
gtcgccattatcgggcggtatattttaacaccggagatttttgatttcctttcattgcaa
aagaccggttcaggcggagaaatccagctgaccgatgccattgaacaattgaatgaaatc
caaaaagtgtatgcctatgcttatgaagggaaacgctacgatgtcggcgaaaagttcggg
tttatcaaatcgacgattgaaatggcactttcccgggaagatctgcgcgatgatttgctc
cggtatttggaagatttgcaatggagaattcaaaaccatcagatctga

DBGET integrated database retrieval system