KEGG   Bacillus coagulans 2-6: BCO26_0567Help
Entry
BCO26_0567        CDS       T01527                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bck  Bacillus coagulans 2-6
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCO26_0567
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_0567
   00620 Pyruvate metabolism
    BCO26_0567
   00650 Butanoate metabolism
    BCO26_0567
  Lipid metabolism
   00071 Fatty acid degradation
    BCO26_0567
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCO26_0567
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCO26_0567
   00626 Naphthalene degradation
    BCO26_0567
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCO26_0567
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BCO26_0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
618812..621424
Genome map
AA seq 870 aa AA seqDB search
MAIDEKVVGKSAQITEMVNSLVAKGQKALREFMELDQAQVDNIVKQMALAGLEQHMVLAK
MAVEETGRGVYEDKITKNLFATEYICHNIKYNKTVGIIDENNNEEIVKFAEPVGVIAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQKCSSHAAKVMLDAAVKAGAPENCIQWIE
KPAIEATQQLMKHSGISLILATGGSGMVKSAYSSGKPALGVGPGNVPCYIEKSADIKRAV
NDLILSKTFDNGMICASEQAVIIDKEIYDHVKNELIANHCYFLNEAEKKKVEKTVINEKT
QSVNSAIVGKPAYEIAKMAGVDVPEDTKILIAELTGVGPDYPLSREKLSPVLACYKASST
KQGFEFAEAMLEFGGLGHSAVIHSTNDEVIEQYGLKMKAGRIIVNSPSSQGAIGDIYNAY
MPSLTLGCGTFGGNSVSTNVGVINLYNVKTMAKRRVNMQWFKIPPRVYFEKNSVQYLEKM
PDISSAFIVTDPDMVRLGFVEKVLYYLRKRPDYVHCEIFSEVEPDPSIETVRKGAEAMAS
FQPDVIIALGGGSAMDAAKGMWLFYEHPEVDFNELKQKFMDIRKRVAKFPKLGEKAQLVC
IPTTSGTGSEVTSFAVISDKKNNTKYPLADYELTPDVAIIDPQFVMTVPKSVTADTGMDV
LTHAIEAYVSNMANDYTDGLAIKAIQLVHEYLPKAYANGSDQLAREKMHNASTLAGMAFS
NAFLGINHSLAHKIGAEFHIPHGRANAILLPHVIRYNAQRPKKFAAFPKYEHFVADQRYA
EIARILGLPASTTEEGVESLCQEIIRMCKLFNMPLSLKAAGVNRADFEKRVAVIADRAFE
DQCTPANPKLPLVSELEDILRKAFEGVEEK
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgatgaaaaagttgttggcaaatccgcacaaatcacggaaatggtaaattcc
ctcgtcgccaaaggccaaaaagcactgcgtgaatttatggaactggatcaggcgcaagtg
gacaatatcgtaaaacaaatggcgcttgcagggctggaacagcatatggtgctcgccaaa
atggccgtggaagaaacagggcgcggcgtatatgaagacaaaattacaaaaaacctgttt
gcaacagaatacatctgccacaatattaaatataacaaaacagtcggcatcattgatgaa
aacaataatgaagaaattgtcaaattcgcggagccagtcggcgttattgccggggtcacg
cctgtaacaaacccgacatcaaccacgatgtttaaagcgttaattgcgattaaaacacgc
aacccgatcattttcgcattccacccgtccgcgcaaaaatgcagcagccatgccgcaaaa
gtcatgctggacgctgctgtgaaagccggcgcgccggaaaactgcatccaatggatcgaa
aaaccggccattgaagcgacacagcaattgatgaaacattcgggcatttcgctgattctt
gcaacgggcggttccggcatggtaaagtccgcatattcgagcgggaaacctgcgcttggc
gtcgggccggggaacgtcccttgctatattgaaaaatctgctgatatcaaacgcgccgtc
aatgacctgattttatccaaaacgtttgacaatggcatgatctgtgcgtcggaacaggct
gtcattatcgacaaagaaatttatgaccatgtaaaaaacgaattgattgcaaatcattgc
tacttcctgaatgaagcggagaagaaaaaagttgagaaaaccgtcatcaatgaaaagacg
caatccgtcaacagcgccattgtcggcaaaccggcctatgaaattgcaaaaatggcaggc
gtggacgtcccggaagataccaaaattttaattgctgaacttacaggcgtcggcccggac
tatccactttccagagaaaaattgagcccggttttggcctgctacaaagccagcagcaca
aaacaaggtttcgaatttgcggaagccatgctcgaattcggcggactcggccactcggct
gtgatccattcgacaaatgatgaagtcattgaacaatacggattaaaaatgaaagccggc
cggatcattgtcaactccccgtcttcgcaaggggcaatcggcgacatttacaatgcctac
atgccttctttgacgctcggttgcggcacgttcggcggcaactcagtgtccacaaacgtc
ggtgtcattaatctgtacaatgtaaaaacaatggcgaaacggagagtcaatatgcaatgg
tttaaaattccaccacgcgtgtattttgaaaagaactcggtccaatatctggaaaaaatg
ccggatatctcaagtgcctttattgtcaccgatccggatatggtccggctcggatttgtt
gagaaagtgctatactacttgcggaaacgaccggactatgtccactgtgaaattttctct
gaagtcgaaccggatccatccattgaaacagtacggaaaggcgccgaagcaatggcaagc
ttccagccggacgtcattatcgcgcttggcggcgggtcggccatggacgctgcaaagggc
atgtggctgttctatgagcatccggaagttgatttcaacgaattgaagcaaaaatttatg
gatatccggaaacgggttgccaaattcccgaaactgggtgaaaaagcgcagctggtctgc
attccgaccacatcgggcaccggttctgaagtgacttctttcgccgtcatttcggataaa
aagaacaatacaaaatatccgctcgcagactacgaactgacgccggatgttgcgatcatt
gacccgcagtttgtcatgaccgtcccgaaatccgtaacagccgataccgggatggacgtt
ttgacccatgcgattgaagcctatgtttccaacatggccaatgactatacggacggcctg
gcaattaaggccatccagcttgttcacgaatacttgccgaaagcatacgcaaatgggagc
gatcaactggcacgcgaaaagatgcacaatgcatcgactttggcagggatggcattctcg
aatgcattccttggcatcaaccattcgcttgcccataaaatcggcgctgaattccatatt
ccgcacgggcgggccaacgcgattctcttgccgcatgttatccgctataatgcgcaaagg
ccgaaaaaatttgcggcattcccgaaatacgaacatttcgtagcggatcagcgctacgcg
gaaattgcgcgtattctcgggctgccggcaagcacgacagaagaaggcgtcgaaagcctt
tgccaggaaattatccggatgtgcaaactgttcaatatgccgcttagcctgaaagcagcc
ggcgtgaaccgggcggactttgaaaaacgggttgccgttattgcagaccgcgcatttgaa
gaccaatgcacgcctgcaaacccgaaattgccgcttgtcagcgaattggaagacatttta
cgcaaagcttttgaaggcgttgaagaaaaataa

DBGET integrated database retrieval system