KEGG   Bacillus coagulans 2-6: BCO26_0586Help
Entry
BCO26_0586        CDS       T01527                                 

Definition
(GenBank) BAAT/Acyl-CoA thioester hydrolase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
bck  Bacillus coagulans 2-6
Brite
Enzymes [BR:bck01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BCO26_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 BAAT_C Esterase DLH Peptidase_S9 PGAP1 Esterase_phd UPF0227 Abhydrolase_3 Abhydrolase_5 Chlorophyllase2 DUF829 Say1_Mug180
Motif
Other DBs
NCBI-ProteinID: AEH52645
UniProt: F7Z2K4
Position
complement(636744..637508)
Genome map
AA seq 254 aa AA seqDB search
MDENYPVLPGADSFFIKGNEIGILISHGFNGTPQSVRFLGRAMASDGFTVCAPRLKGHGT
HYLDMERCTYKDWIDSLEEGYQLLKRHCRDIFVIGQSMGGTLALHLAEKHPDIRGMVCIN
AAIQSIPELEKCLAKGRYIQEGPPDIKAAGVHEIAYEKVPAASIRELLSVMRETRENLSA
IHCPALFFQSTEDHVVPPENTDYIAAHILASRKKIIPLRNSYHVATMDHEKEWIAAQCSS
FVQEIAHIESRTEI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaactatcccgttctcccgggtgcagattccttttttataaaaggaaatgaa
attggcattctcatctcgcatggattcaacggcaccccgcaaagtgtccgctttttggga
agggcaatggcatcggacgggtttacggtttgcgcgccaagattaaaggggcacgggacg
cactatttggacatggaacgctgcacttacaaagactggattgacagccttgaagagggt
tatcagctgctgaaacggcattgccgcgatatttttgttatcggccagtcaatgggcggc
acgctggctttgcatctcgcggaaaaacacccggatatccggggaatggtgtgtatcaac
gcggccatccaaagcatccccgaactggaaaaatgcctggcgaaagggcggtatattcaa
gagggcccgccggatatcaaagcagcgggcgtgcatgaaattgcatatgaaaaagtgccg
gcggcttccatccgtgagcttctgtccgtgatgcgggaaacgcgggaaaacctctccgcc
atccattgccccgcactgtttttccaatcaacagaagaccatgtcgtgcctcctgaaaat
acagattatattgccgcgcatatccttgccagccggaaaaaaatcattccgctccgcaac
tcttatcacgtcgctacaatggatcatgaaaaagaatggattgcggcacaatgttcatca
tttgttcaagaaattgcgcatatcgaatcccgtacggaaatatga

DBGET integrated database retrieval system