KEGG   Bacillus coagulans 2-6: BCO26_0601Help
Entry
BCO26_0601        CDS       T01527                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bck  Bacillus coagulans 2-6
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BCO26_0601
  Lipid metabolism
   00561 Glycerolipid metabolism
    BCO26_0601
   00600 Sphingolipid metabolism
    BCO26_0601
Enzymes [BR:bck01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BCO26_0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(652888..655080)
Genome map
AA seq 730 aa AA seqDB search
MITFDEQTKTFHLQNDEVSYLLQVDAFGCVEHLYWGAPVRAYHGGRAYPRIGRSFSPNPP
GAKDRKFSLDTVLQEFPGYGNGDFREPAHVIRHADGSTVTDFRYRAYDILKGKPALPGLP
ATFANPNEAETLKIMLEDKLTGLQLTLLYTIFRDLPAISRAAVLTNGGNKPVRIERLMSL
NVDFPAGRFELLHLPGAHKRERQIKRETVTDGIRRVDSKRGASSHQENPFLALVRPETTE
FQGEAYAVNLVYSGNFAGMVQQDQFGQVRFEIGLNDFGFSWALQPGDTFYSPEAVMAYSR
DGLNGMSQTFHTLYRRHLLRGKHKDAERPVLINNWEATYFRFHDQKLLELADEAQKLGIE
LFVLDDGWFGHRDNDRSSLGDWYEYAGKIRMGIKNLAEEIHKRGLKFGLWFEPEMVSRDS
DLFREHPDWALQIPGRGISEGRSQYVLDFSRGDVRENIFRQMTDILDHVHVDYIKWDMNR
HMTEVHSALLEPENQGETAHRYMLGLYDFLEKLTSRYPDILFESCSGGGGRFDPGMLYYM
PQTWTSDNTDAADRLKIQYGTSLAYPPVTMGAHVSAVPNHQTGRVTPLSTRGDVAMGGNF
GYELDLTKCTEDEKAVIREQIAFYKAHRQLFQFGQFYRLISPFEGNSAAWQFVSPDRKHT
IAYFFNVLSEAAGPVKILKLAGLDPDKNYRHIETGNIYGGDELMNIGLYLPLFNKQDFAS
YKAEFEAVYE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgattacatttgatgaacaaacgaaaactttccatttgcaaaatgatgaagtgagttac
ctcttacaagtggatgcattcggctgcgttgaacatctgtattggggagcgccggtcagg
gcctaccacggggggcgcgcctatccccgcatcggccgcagtttttccccgaacccgccc
ggtgcaaaagaccgcaaattttcactggatacggtgctgcaggaattcccgggatacggc
aacggcgatttccgtgagccggcgcatgttatccggcatgcggacgggtcaacggtcacg
gacttccgctaccgggcgtatgacattttaaaaggcaagccggcgcttcccgggcttccc
gctacttttgccaatccaaatgaagccgaaacattgaaaatcatgctggaagacaaactc
acaggccttcaattaacgcttttatacaccatctttcgcgacttgccggcgatttcccgc
gcggctgtgctgacaaacggcggaaacaagcctgttcggattgaacgtttgatgagcctg
aatgtcgatttcccggccggacgttttgagctgttgcatctccccggcgcccataaacgc
gaacggcaaatcaaaagagaaacggtaacggacgggatcaggcgtgtagacagcaaacgc
ggcgccagcagccaccaggaaaatccttttttggcgcttgtccggcctgaaacaacggaa
ttccaaggtgaagcatatgcggtgaacctcgtttacagcggcaattttgctggaatggtg
cagcaggaccagttcggccaggtacgctttgaaatcgggctgaatgatttcgggttcagc
tgggcgttgcagccgggtgacactttttattcccctgaagcagtgatggcatacagcaga
gacgggctgaacgggatgtcgcaaacgtttcacacgctctaccgccgccatcttttgcgc
ggcaaacataaagatgcggaacgcccggtgttgatcaacaactgggaagcgacctatttc
cggtttcatgatcaaaaattgcttgaactcgccgacgaggcgcaaaagctcggcattgag
ctgtttgtgctggatgacggctggttcggccaccgggacaatgaccgcagttctttaggg
gactggtatgaatacgccggaaaaatccggatggggatcaaaaatctggcggaagaaatc
cataaacgcggcttgaaattcgggctctggtttgaaccggaaatggtttcgcgggacagt
gaccttttccgtgaacatccggactgggcattgcaaattccgggccgcgggatttccgaa
gggcgctcccaatatgtgctcgattttagccgcggggatgtgcgcgaaaatattttccgg
cagatgacggatattctggatcatgtccatgtcgattatatcaaatgggatatgaaccgc
catatgacagaagtccattccgccctgctggaaccggaaaaccagggagaaaccgcccac
cgctatatgctcgggctgtatgactttttagaaaagttgacgtcgcgttaccctgacatt
ttgtttgaaagctgttccggcggcggcgggcgttttgatccgggcatgctgtattatatg
ccgcaaacgtggacgagcgataataccgatgcggccgaccggctgaaaatccagtacggc
acaagcctcgcctatccgccggttaccatgggcgcgcatgtttcggccgttccgaaccac
caaaccggccgggttacgccgctatcgacgcgcggtgacgtggcaatgggcggcaatttc
ggctatgagttggatttgacaaaatgcacggaagatgaaaaagcagtgatccgggagcag
attgcattttacaaagcacaccgtcaattgttccagtttggccagttttaccgcctgata
agcccgtttgaaggcaacagcgccgcctggcaatttgtctcgccggaccggaaacatacc
attgcctattttttcaacgtactatctgaagcagccggcccggtgaaaatattaaaactg
gcaggccttgacccggacaaaaactaccggcatattgaaacaggcaacatttacggcggc
gacgaactgatgaacatcgggctgtatttgccattgtttaacaaacaggactttgcaagc
tacaaagcagagtttgaggcggtgtacgagtaa

DBGET integrated database retrieval system