KEGG   Bacillus coagulans 2-6: BCO26_0625Help
Entry
BCO26_0625        CDS       T01527                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00010  Glycolysis / Gluconeogenesis
bck00052  Galactose metabolism
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
Module
bck_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_0625
   00052 Galactose metabolism
    BCO26_0625
Enzymes [BR:bck01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BCO26_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim FtsK_SpoIIIE_N
Motif
Other DBs
NCBI-ProteinID: AEH52684
UniProt: F7Z2P1
Position
684210..685250
Genome map
AA seq 346 aa AA seqDB search
MEIKKALFGELEGRPVHAYELKNDRGISVTVLEYGCIINKIIVPDKNGKAENIVLGYDNL
DGYLHGVPYFGAIIGRIAGRIAGASFELDGKTYKLSANENRNHLHGGFKGFNAVIWDSTP
IEQDGAVGVKFTYTSPDGEEGYPGNLDATVTYLLTNEQELKLSYQAHTDKKTIVNMTNHA
YFNLSGDMKRDVRGHELQIPSGRVLELGRETLPTGKTFDVRGTAFDFRNGRKIEDGTVSD
HPQNVLVGNGYDHAFLLPETEKPIRLKDEESGRMLTVETDQPCVVVYTSNTMGNDTYEIR
GRKPCDYLAVCLETQGVPDAIHHPEYPSVILEPGETYRAHTKWIFG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaaaaaggcattgtttggggaattggaaggacgtccggtccatgcttatgaa
ttgaaaaatgaccgcggcatatctgtaacggtgcttgaatacggttgcatcatcaataag
atcatcgtgccggacaaaaacggcaaagcggaaaacatcgtgctcgggtatgacaacctt
gacggctacctccatggtgttccgtatttcggcgctattatcggccgtattgccggcagg
atcgccggagcatcttttgaactggacggcaaaacatacaagctttctgccaatgaaaac
cgcaaccatctccatggcggcttcaaagggttcaacgccgtcatctgggacagcacgccc
attgaacaagacggcgcagttggtgtgaaatttacgtatacaagcccggacggcgaagaa
ggctatcccggaaatctcgatgccaccgtgacctatcttttaacaaatgaacaagaactg
aagctgtcttatcaggcacatacggataaaaaaacgatcgtcaacatgaccaatcatgca
tacttcaatttaagcggcgacatgaaacgcgatgtgcgcggccatgaactacaaatcccg
agtggccgtgtgctggaacttggccgggaaacgctgccgacagggaaaacttttgatgtt
agaggtaccgcattcgatttccggaacgggcgaaaaatcgaagacggcacggtatcggat
catccgcaaaacgtccttgtcggaaacggctatgaccacgcgtttttattgccagaaacg
gaaaaaccgatccgcttaaaagacgaagagagcgggcgcatgctaacggtggaaaccgac
cagccttgcgtcgtcgtttatactagcaatacgatgggaaatgacacatatgaaatccgc
ggccgcaagccttgtgattatttggcggtctgcctcgagacgcagggtgtgccggatgcg
atccatcaccctgaatacccgtctgtgattctggagccgggtgaaacataccgcgcccat
acaaaatggatttttggctga

DBGET integrated database retrieval system