KEGG   Bacillus coagulans 2-6: BCO26_0779Help
Entry
BCO26_0779        CDS       T01527                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bck  Bacillus coagulans 2-6
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCO26_0779
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BCO26_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
845079..846509
Genome map
AA seq 476 aa AA seqDB search
MAGNRKKVAVLGGGITGLTAAYYLRRLVEDQQLPFDVILLEKGRRLGGKIQTVRRDGFVI
ERGPDSFLARKQSALHLAEDLGLSPSLVSNATGKSYILLNQQLYPVPRGSVMGIPTRLAP
FFASPLFSVTGKIRALCDLILPRKNTGEDRSVGDFVRYRLGEEVLENLVEPLLFGVYAGD
VDELSVLATQPQFFEAVQKHRSLILGMKKVAAEFAQDSRPTRNKGAFLTFQNGLETLVEA
LEEKIGAEAVMKGVTVDTVELSTGGGDYRITLTNGTCITADYIISALPHFSLPHIFSKYA
FFAPLEKVPSTSVATVSMAFPESAVKKDIDGTGFVVTRNSDYTITACTWTHKKWPHTAPE
GKALLRCYIGRSAESAVVDLADDRIQKIVLEDLNKIMEITAEPEFTVVSRWKYAMPQYTV
GHKARIGKILAAAKNELPGISFAGSSFNGVGVPDCISQGRAAVGEMLRYFRIRAEF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaacagaaaaaaagtagctgtgcttggcggcggaatcaccggcttgacagct
gcttattatttgcggcgccttgttgaggaccaacagctgccgtttgatgtgatattgttg
gaaaaagggcgccggcttggcggaaaaatccagacggtcaggcgggacggatttgtcatt
gaacgcgggccggattcttttctggcaagaaagcaaagcgctttgcatctggcagaagat
ctcgggctgtcgccttccctcgtatccaatgcgacaggcaaatcttatattttattaaac
caacagctctatccggtgccaagaggttctgtgatgggcattccgacaagattggcgcct
ttttttgcttcccctttgttttctgttaccggcaaaatccgggcgctctgcgatttgatc
ctgccccggaaaaataccggcgaagaccggtcagtcggggattttgtccgctaccggctc
ggtgaagaagtgctggaaaaccttgtcgaaccattattgttcggggtgtatgccggagat
gtcgacgagctgagcgtgctggcaacgcagcctcaatttttcgaggctgtccaaaaacac
cgaagcctgatcctcggcatgaaaaaagtagcggcggaatttgcgcaagactccaggcca
acccggaataagggggcttttttaacctttcaaaacggcctcgaaacgctcgttgaagca
cttgaagaaaaaatcggcgctgaggcggtcatgaagggcgtgacagtggatacggttgaa
ttgagtacgggcggcggggattacaggatcacactgacaaatggaacctgcatcacagcg
gattatattatctcggcccttcctcatttttcgctcccccatattttttcaaagtatgct
ttttttgcgccgcttgaaaaggtgccatccacatctgttgcaacagtctcgatggcgttt
ccggagagcgcggtgaaaaaagacattgacgggacaggctttgtggtgacgagaaacagt
gattatacaattaccgcctgcacctggacgcataaaaaatggccgcatacagcaccggaa
ggaaaggcgttgctccgctgctatatcggccggtcagcggaatccgcagtcgtcgatctc
gcggatgacaggattcagaaaatcgtgctggaagatttaaataaaatcatggaaataaca
gcagaaccggagtttactgttgtttcccgctggaaatatgcgatgccgcaatatacggtg
ggccataaagcaagaatcgggaaaattttagcggcagccaaaaacgaattgccgggtatt
tcttttgccggaagctcgtttaacggggtcggcgtgccggactgcatctcccagggaagg
gcggcggttggcgagatgctccggtacttccggattcgggctgaattttaa

DBGET integrated database retrieval system