KEGG   Bacillus coagulans 2-6: BCO26_0964Help
Entry
BCO26_0964        CDS       T01527                                 

Gene name
pdhC
Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bck  Bacillus coagulans 2-6
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bck01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bck00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bck00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bck00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1027936..1029270
Genome map
AA seq 444 aa AA seqDB search
MGRILKKRSVNTLSFEFRLPDIGEGIHEGEIVKWFIKPGDKVSEDDVLCEVQNDKSVVEI
PSPVEGTVEEILVDEGSVAVVGDVLVKFDAPGYENLQFKGDHGHDQKEEAAESAKPEPAK
QETAETAKPAEKEAEHGSESADRRVIAMPSVRKYAREKGVDIRLVSGTGKNGRVLREDID
AYVNGPQQTETEAGKTEAQAPDSQDAVPEGEFPETREPMSGIRKAIAKAMVNSKQTAPHV
TLMDDVDVTALVAHRKKFKEIAAEKGIKLTFLPYVVKALVSTLREYPVLNSSIDDETNEI
IHKHYYNIGIAADTERGLLVPVVKHADRKPVFAVSKEINELAEKARDGKLAPNEMKGASI
TISNIGSAGGQWFTPVINRPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRIIDG
ATAQNALNHIKRLLHDPELLLMEA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcattttgaaaaaaaggagcgtgaacaccttgtcatttgaattcaggctgccg
gatatcggcgaagggatccatgaaggcgaaattgtaaaatggtttattaaaccgggtgat
aaagtttcggaagacgacgtgctctgtgaagtgcaaaatgacaaatcggttgtcgaaatt
ccgtcccctgtggaagggaccgttgaagaaattcttgttgacgaaggaagcgtcgcagtt
gtcggtgatgtccttgtaaaattcgatgcgcccggatatgaaaatcttcaatttaaaggg
gaccatgggcacgatcagaaagaagaagcagcagaaagtgcaaaaccggaaccggcaaaa
caggaaacagctgaaactgccaagcctgctgaaaaagaagcagaacacggatccgaatcc
gcggatcgccgcgtgatcgcgatgccatccgtacggaaatatgcccgtgaaaaaggcgtc
gatatccggcttgtgtccggaaccggaaaaaacggccgcgtgctccgcgaagatatcgat
gcgtatgtgaacgggccgcagcagacggaaacggaagccggcaaaaccgaagcacaggcg
cctgattcccaagatgctgtgcctgaaggggaattccctgaaacacgcgaaccgatgagc
ggcatccgcaaagcgattgcaaaagcgatggtcaactcgaaacaaaccgcgccgcatgtt
acgctgatggatgatgtcgatgtgacggcactggtcgcgcaccggaaaaaattcaaagag
atcgcggcagaaaaaggcatcaaactgactttcctgccatatgtcgtaaaagcgctcgtc
agcacgctgcgggaatacccggttttaaatagttcgattgatgatgaaacgaatgaaatc
atccataagcattattacaatatcgggattgccgctgatacggagcgcggcttgcttgtg
ccggtcgtcaaacacgccgaccgcaaaccggtatttgcggtttccaaagaaattaatgaa
ctggctgaaaaagcaagagatggaaagcttgccccgaacgaaatgaaaggcgcttccatt
acgatttccaatatcggttccgccggtgggcaatggtttacaccggttatcaaccgtccg
gaagtggctattttaggaatcggccggattgcagaaaagccggtcgttaaaaacggtgaa
attgttgcagcgcctgtactggcgttgtcgctcagttttgaccaccgtatcatcgatggt
gccaccgcacaaaatgcgttaaatcatatcaaacgtttgttgcatgatccagaactttta
ttaatggaggcgtaa

DBGET integrated database retrieval system