KEGG   Bacillus coagulans 2-6: BCO26_0964Help
Entry
BCO26_0964        CDS       T01527                                 

Gene name
pdhC
Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00010  Glycolysis / Gluconeogenesis
bck00020  Citrate cycle (TCA cycle)
bck00620  Pyruvate metabolism
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
bck01200  Carbon metabolism
Module
bck_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_0964 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BCO26_0964 (pdhC)
   00620 Pyruvate metabolism
    BCO26_0964 (pdhC)
Enzymes [BR:bck01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCO26_0964 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AEH53023
UniProt: F7Z3K2
Position
1027936..1029270
Genome map
AA seq 444 aa AA seqDB search
MGRILKKRSVNTLSFEFRLPDIGEGIHEGEIVKWFIKPGDKVSEDDVLCEVQNDKSVVEI
PSPVEGTVEEILVDEGSVAVVGDVLVKFDAPGYENLQFKGDHGHDQKEEAAESAKPEPAK
QETAETAKPAEKEAEHGSESADRRVIAMPSVRKYAREKGVDIRLVSGTGKNGRVLREDID
AYVNGPQQTETEAGKTEAQAPDSQDAVPEGEFPETREPMSGIRKAIAKAMVNSKQTAPHV
TLMDDVDVTALVAHRKKFKEIAAEKGIKLTFLPYVVKALVSTLREYPVLNSSIDDETNEI
IHKHYYNIGIAADTERGLLVPVVKHADRKPVFAVSKEINELAEKARDGKLAPNEMKGASI
TISNIGSAGGQWFTPVINRPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRIIDG
ATAQNALNHIKRLLHDPELLLMEA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcattttgaaaaaaaggagcgtgaacaccttgtcatttgaattcaggctgccg
gatatcggcgaagggatccatgaaggcgaaattgtaaaatggtttattaaaccgggtgat
aaagtttcggaagacgacgtgctctgtgaagtgcaaaatgacaaatcggttgtcgaaatt
ccgtcccctgtggaagggaccgttgaagaaattcttgttgacgaaggaagcgtcgcagtt
gtcggtgatgtccttgtaaaattcgatgcgcccggatatgaaaatcttcaatttaaaggg
gaccatgggcacgatcagaaagaagaagcagcagaaagtgcaaaaccggaaccggcaaaa
caggaaacagctgaaactgccaagcctgctgaaaaagaagcagaacacggatccgaatcc
gcggatcgccgcgtgatcgcgatgccatccgtacggaaatatgcccgtgaaaaaggcgtc
gatatccggcttgtgtccggaaccggaaaaaacggccgcgtgctccgcgaagatatcgat
gcgtatgtgaacgggccgcagcagacggaaacggaagccggcaaaaccgaagcacaggcg
cctgattcccaagatgctgtgcctgaaggggaattccctgaaacacgcgaaccgatgagc
ggcatccgcaaagcgattgcaaaagcgatggtcaactcgaaacaaaccgcgccgcatgtt
acgctgatggatgatgtcgatgtgacggcactggtcgcgcaccggaaaaaattcaaagag
atcgcggcagaaaaaggcatcaaactgactttcctgccatatgtcgtaaaagcgctcgtc
agcacgctgcgggaatacccggttttaaatagttcgattgatgatgaaacgaatgaaatc
atccataagcattattacaatatcgggattgccgctgatacggagcgcggcttgcttgtg
ccggtcgtcaaacacgccgaccgcaaaccggtatttgcggtttccaaagaaattaatgaa
ctggctgaaaaagcaagagatggaaagcttgccccgaacgaaatgaaaggcgcttccatt
acgatttccaatatcggttccgccggtgggcaatggtttacaccggttatcaaccgtccg
gaagtggctattttaggaatcggccggattgcagaaaagccggtcgttaaaaacggtgaa
attgttgcagcgcctgtactggcgttgtcgctcagttttgaccaccgtatcatcgatggt
gccaccgcacaaaatgcgttaaatcatatcaaacgtttgttgcatgatccagaactttta
ttaatggaggcgtaa

DBGET integrated database retrieval system