KEGG   Bacillus coagulans 2-6: BCO26_1155Help
Entry
BCO26_1155        CDS       T01527                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bck  Bacillus coagulans 2-6
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bck00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCO26_1155
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BCO26_1155
Enzymes [BR:bck01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BCO26_1155
Two-component system [BR:bck02022]
 CheA family
  CheA-CheYBV
   BCO26_1155
Bacterial motility proteins [BR:bck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BCO26_1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1205346..1205726
Genome map
AA seq 126 aa AA seqDB search
MLKPGAVYIAPGDFHMGVEARGAHLFIRLEQSAPVNGHRPAVDKTFESVSMLKNYETLAV
IMTGMGSDGTKGLIALKNRGHVRAIVEAEESCIVYGMPRSAIAAKVVDEVLPLEKIAEAI
MKFISD
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagccgggggcggtttatattgcgcccggggacttccatatgggcgtggaggcg
cgcggcgcacatctctttatccggcttgagcaatccgcgccggttaacgggcacaggccg
gctgtggataaaacatttgaatcggtgagcatgctgaaaaactatgaaacacttgccgtc
atcatgaccgggatgggttcagacggaacaaaaggtttgatcgcgttaaagaatcgcggg
catgtaagagcgattgtcgaagcggaagaaagctgcatcgtttacggcatgccgagaagt
gccattgccgcgaaagtggtggatgaagttttgccgctggaaaaaattgcggaggcaatc
atgaaatttattagtgattag

DBGET integrated database retrieval system