KEGG   Bacillus coagulans 2-6: BCO26_1155Help
Entry
BCO26_1155        CDS       T01527                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bck  Bacillus coagulans 2-6
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bck02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bck02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1205346..1205726
Genome map
AA seq 126 aa AA seqDB search
MLKPGAVYIAPGDFHMGVEARGAHLFIRLEQSAPVNGHRPAVDKTFESVSMLKNYETLAV
IMTGMGSDGTKGLIALKNRGHVRAIVEAEESCIVYGMPRSAIAAKVVDEVLPLEKIAEAI
MKFISD
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagccgggggcggtttatattgcgcccggggacttccatatgggcgtggaggcg
cgcggcgcacatctctttatccggcttgagcaatccgcgccggttaacgggcacaggccg
gctgtggataaaacatttgaatcggtgagcatgctgaaaaactatgaaacacttgccgtc
atcatgaccgggatgggttcagacggaacaaaaggtttgatcgcgttaaagaatcgcggg
catgtaagagcgattgtcgaagcggaagaaagctgcatcgtttacggcatgccgagaagt
gccattgccgcgaaagtggtggatgaagttttgccgctggaaaaaattgcggaggcaatc
atgaaatttattagtgattag

DBGET integrated database retrieval system