KEGG   Bacillus coagulans 2-6: BCO26_1168Help
Entry
BCO26_1168        CDS       T01527                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00900  Terpenoid backbone biosynthesis
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01130  Biosynthesis of antibiotics
Module
bck_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCO26_1168
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BCO26_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: AEH53227
UniProt: F7Z448
Position
1216356..1217258
Genome map
AA seq 300 aa AA seqDB search
MVETAVYAESDILVNAVLGSVGLLPTLEAIRAGKTVAIANKETLVTAGHLVMDAAKRAGT
AILPIDSEHSAIFQCLQGENRNEIERLIITASGGSFRDYTREQLETVTVKDALNHPNWSM
GAKITVDSATMMNKGLEVIEAHWLFGLPFEKIDTILHRESIIHSLVEFRDGSVKAQLGMP
DMRIPIQYALGFPKRLPLPDAKRLHLAEIGRLHFEKMDEERFYCLKLAYEAGKAGGSMPA
VLNAANEAAVHAFLQEKIAFLQIDQLIEKALARHNVIIHPDLETIRAVDRETRDYVASLM
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaacggcagtatatgccgaatcggatattttggtcaatgcggtgcttggcagt
gtcgggctgttgccgactttggaggcgatccgggcggggaaaaccgtggcaatcgccaat
aaagaaacgctcgtcacagccggccatctcgttatggatgcagcaaagcgcgccggcact
gccattcttccaattgacagtgaacattccgccatttttcaatgtttgcaaggggaaaac
cggaatgaaatcgaacggctcatcattaccgcatccggcggcagcttccgtgattataca
agggagcagcttgaaactgtcactgtaaaagatgcgctgaaccatccgaactggtcgatg
ggtgccaagatcacggttgattcggcaacgatgatgaataaagggctcgaggtcattgaa
gcacattggctgttcggccttccctttgaaaaaattgatacgatcctgcaccgcgaaagc
atcatccactctctcgtggaattccgtgacggcagtgtgaaggcgcagcttggaatgccc
gatatgcgcatcccgatccaatatgcgctcgggtttccaaaaaggctgccgcttccggat
gcaaagcggctccatttggcggaaatcggccggcttcattttgaaaaaatggatgaagaa
cgattttactgcctgaaacttgcctatgaagccggaaaagccggcggatcgatgccggcc
gtgctgaatgcggccaatgaagcggcggtccatgcctttttgcaggaaaaaatcgcgttt
ttgcaaattgatcagttgattgaaaaggcgcttgcaaggcataatgtaattatacaccct
gatttggaaacgatccgggccgttgaccgtgagacgcgggactatgtggcctcgctcatg
taa

DBGET integrated database retrieval system