KEGG   Bacillus coagulans 2-6: BCO26_1276Help
Entry
BCO26_1276        CDS       T01527                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bck  Bacillus coagulans 2-6
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCO26_1276
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCO26_1276
  Amino acid metabolism
   00310 Lysine degradation
    BCO26_1276
Enzymes [BR:bck01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCO26_1276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1332325..1333593
Genome map
AA seq 422 aa AA seqDB search
MAEIKVPELAESITEGTIAQWLKHPGDHVDKGEYIVELETDKVNVEVISEEEGVVQSLLF
EEGDTVQVGDVIAIVGEGTGENNATPSAPPKEAEAPQPAQAQALGQTQAPAPEQPKPAQE
ESESRPVASPAARKLAREKGIDLSQVPTVDPLGRVRKQDVETFNPQAAAKAPAAPEKPAA
GKAVAEEAGKPVERIRMSRRRQTIAKRLVEVTQTTAMLTTFNEIDMSAVMDLRKRKKEQF
VKDHDIRLGFMSFFTKAVVAALKKYPYVNAEIQGNELLLKKYYDIGIAVSTEEGLVVPVV
RDCDRKSFAEIEADIAAFAQKARDNKLALSDLQGGTFTITNGGVFGSLFSTPIINGTQVG
ILGMHTIQKRPVAVDGDRIEIRPMMYVALSYDHRVIDGKDAVGFLKTVKTLIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaattaaagtgcctgaactggcagaatccatcacggaaggaaccattgcacaa
tggctgaaacatccgggggaccatgtagataaaggggaatatattgtagaacttgagaca
gataaagtaaatgtagaagtcatttcggaagaagaaggcgtcgtccagtccctccttttt
gaagaaggagacacagtccaagtcggcgatgtcattgcgattgtcggcgaaggaacaggg
gaaaacaacgcaacgccttccgcgccgccaaaagaagcggaagcaccgcaaccggcacaa
gcacaggcgctggggcaaacacaagcgcctgccccggagcagccaaagccggctcaggaa
gaaagcgaaagccgcccggttgcttctccggctgcccgcaaactggcacgtgaaaaaggc
attgacttatcgcaagtgccgacagtggatccgcttggcagggtaaggaaacaagatgtg
gaaaccttcaatccgcaagctgcggcaaaagcgccggcagcaccggaaaaacctgcagcc
ggcaaagctgtggcagaagaagccggcaaaccggttgaaagaatccgcatgtcacgccgc
cgccagacgatcgcaaaacggctcgttgaagtgacacagacaacggcgatgctgacgaca
ttcaacgaaattgatatgtcggccgtcatggatttaagaaagcgaaaaaaagaacagttc
gttaaagatcatgacatccgtctcggctttatgtcgttctttacaaaagcagtggttgcg
gcattgaagaaatatccgtatgtcaatgcggaaattcagggcaatgagctgctcttgaaa
aaatattatgatatcggcattgcggtatccacggaagaagggcttgtcgtgccggttgtc
cgggattgcgaccggaaatcgttcgcggaaattgaagcggatattgctgcatttgcccaa
aaagcacgtgataataaacttgcattaagcgatctgcagggcggaacctttacgattaca
aacggcggcgtctttggctcgttgttctcaacgccgattatcaacgggacacaggttggc
atcctcggcatgcacaccattcaaaaacgcccggttgcagtcgatggggaccggattgaa
atccgcccgatgatgtacgtggcgctttcctatgaccaccgcgtcattgacggaaaagat
gctgtcggtttcttgaaaacggtgaaaacattaattgaaaatcctgaagatttgctgctg
gaatcttaa

DBGET integrated database retrieval system