KEGG   Bacillus coagulans 2-6: BCO26_1296Help
Entry
BCO26_1296        CDS       T01527                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bck  Bacillus coagulans 2-6
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCO26_1296
  Amino acid metabolism
   00340 Histidine metabolism
    BCO26_1296
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BCO26_1296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1355200..1356483
Genome map
AA seq 427 aa AA seqDB search
MIREYTKKAFAETFLQSKNKSGAHDEDVLRTAKEVLEDIRLNGDAAVKKYAAQFDGEVPE
PWEVSPEERIQAWREVPQDVISALQKAAENIRRFHAKQLQNSRIMEMNENIISGQLFRPV
EKAGIYVPGGTACYPSSVLMNAIPAVLAGVEEVVMATPARNGTKIAPVLSVAADIAGVGT
IYKLGGIQAIGALAYGTETIPAVDKIAGPGNAYVAAAKSLVYGTAGIDMIAGPSEVAIIA
DENANPAYIAADLIAQAEHDERARTFLLTTSQKLINETKAELEKQLVVLPRRGIAEVSIK
MQSAAVLVASIDEAFALSNRLAPEHLEIQVENPLLQLSKVKNAGSVFLGENTPEAIGDYY
GGPNHVLPTSGTARFSSGLSVDDFYKKITYLYYGEKALQQAAPDVMAIAAQERLEGHARA
VQKRVKG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgatacgggaatacacaaaaaaagcatttgccgaaacgtttctgcaatcgaaaaacaag
agcggcgcgcacgatgaagacgtgctccgcaccgcgaaggaagtgctggaagacatccgc
ttaaacggggatgccgccgtgaaaaaatatgccgcccaatttgacggggaagtgccggaa
ccgtgggaagtttctccggaagaacgcatacaggcatggcgcgaagttccgcaggatgtg
atttccgccttgcaaaaagcagcggaaaatatccgccgtttccacgcgaaacagctgcaa
aactcccggatcatggaaatgaatgaaaatatcatttcaggccagctgttccggccggtg
gaaaaagccgggatttatgtgccgggcgggaccgcctgctatccgtcatccgtccttatg
aacgcgatccccgctgtccttgccggcgtagaagaagtggtcatggcgacaccggccaga
aacggcacgaaaattgcccctgttttgtccgtagcggccgatattgccggtgtcggcacc
atttacaaacttggcggcatccaggcgatcggggcgcttgcatacggcacggaaacgatt
cctgcagtcgataaaattgccggccccgggaacgcatatgtcgccgccgccaaatcgctt
gtatacggcacggccggcatcgatatgatcgcaggcccgtcggaagtcgccatcattgcc
gatgaaaatgccaacccggcatatatagcggccgatctgatcgcccaggccgaacacgac
gaacgcgcaagaacgtttctcctcacgacgtcgcagaaactgataaatgaaacaaaagcg
gaacttgaaaaacagcttgttgtccttccgcgtcgcggcatcgcggaagtgtccatcaag
atgcaaagcgcagccgtgcttgttgcatcgatagacgaagcttttgcgctttcaaaccgg
cttgccccggaacacttggaaatccaggtggaaaacccgctcttgcagctgtcgaaagtg
aaaaatgccggctccgtttttctcggcgaaaacacgccggaagccatcggcgattattac
ggcggcccgaaccacgtcctgccgacatcgggaacggcgcggttttcttccggtttgtct
gttgatgatttttataaaaaaatcacctatttgtattatggtgaaaaagctttacagcaa
gcggcgccggatgtgatggcgattgctgcacaagagcggctcgaagggcatgcgcgggcg
gtccaaaaacgggtgaaagggtga

DBGET integrated database retrieval system