KEGG   Bacillus coagulans 2-6: BCO26_1319Help
Entry
BCO26_1319        CDS       T01527                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bck  Bacillus coagulans 2-6
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bck00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1371996..1372643
Genome map
AA seq 215 aa AA seqDB search
MIVSGQKEHQLIEETFKDQIDHPAVISKKLEQSGQFMEAVRSLIDLCGDDPGRDGLQETP
YRVLKAFLEYTEGYREDPKLHLAKTFDVDHDHKELVLVKDIEFYSICEHHFAPFFGVAHV
AYLPNEKITGLSKIARMVDGYARRFQVQERLTKQIADAVEEVLEPQGTMVVLEAKHMCMC
GRGVKKADASTTTMSYRGIFEGRADLRAEFLSLLK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttccggacaaaaggaacatcaactaatagaagaaacttttaaagatcaaata
gatcatcctgctgtgatcagcaaaaaactcgagcagtcaggccaatttatggaagccgtc
cgcagcctgattgatttatgcggcgatgatccgggccgcgacggattgcaggaaacacct
taccgggtgctgaaggcctttttggaatatacagaggggtaccgggaagacccgaaattg
catttggcaaaaacatttgacgtcgaccacgaccataaggagctcgtactcgtaaaagat
atcgaattttattccatatgcgagcaccacttcgcgccatttttcggcgtcgcgcatgtc
gcctatttgccaaacgaaaaaatcaccggcctgtcgaaaattgcgcgcatggtcgacggc
tacgccaggcgttttcaggtccaggaacggctgacaaaacaaattgcggatgcggtggaa
gaggtgcttgaaccgcagggcacgatggtggttttagaggccaagcatatgtgcatgtgc
gggcggggcgtgaaaaaggcggatgcgtccacgacaacgatgtcctaccgcggcattttt
gaagggcgggcggatttgcgcgccgaatttttatccttgctcaaatag

DBGET integrated database retrieval system