KEGG   Bacillus coagulans 2-6: BCO26_1408Help
Entry
BCO26_1408        CDS       T01527                                 

Gene name
acoC
Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00010  Glycolysis / Gluconeogenesis
bck00020  Citrate cycle (TCA cycle)
bck00620  Pyruvate metabolism
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
bck01200  Carbon metabolism
Module
bck_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_1408 (acoC)
   00020 Citrate cycle (TCA cycle)
    BCO26_1408 (acoC)
   00620 Pyruvate metabolism
    BCO26_1408 (acoC)
Enzymes [BR:bck01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCO26_1408 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H MurB_C PYNP_C DUF2118
Motif
Other DBs
NCBI-ProteinID: AEH53467
UniProt: F7Z4T3
Position
1464081..1465289
Genome map
AA seq 402 aa AA seqDB search
MPVEVIMPKLGMAMKEGTVSQWNKTEGEAVKKGDPIASISSEKIEMEIESPADGSVLKIN
VPEGKGVPPGTVICYIGNPDEEVAATAAPVQEEKGQKEEIQAAHPAPPPKKPGKARVKIS
PVARKMAEASGIKPEDIIGTGPGGRITKEDVEQAIASAKESRKQDIPVQAVAEEPQRIPV
SGMRKVIAERMHLSLQSAAQLTITMKADVTELLALKTQVKETIAKRYGSKLTITDFAARA
AILALENHPEMNSAFMDNTIVTYLEIHLGIATAVEKGLVVPVIRHAESKSLIDLAKEIKE
KAAAARAGKLPADEMQGSTFTISSLGASGVEFFTPILNPPEAGILGVGAVSDEAVFIGDK
IEKRSRLPLSLTFDHRVLDGAPAAAFLQTVKQYLEEPVTMLL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgccggttgaagtcattatgcccaaacttgggatggcaatgaaagaaggaaccgtttca
cagtggaataaaacagaaggagaagccgttaaaaaaggcgacccgatcgccagcatcagt
tcagaaaaaatagaaatggaaatcgagtcccctgcggacggcagtgtattaaaaatcaat
gtgccggaaggaaagggagtgccgccgggaacggtgatttgctatatcggaaatccggat
gaagaagtggcggcaacagcagccccggtgcaggaagaaaaaggccaaaaagaagaaata
caggcggcacatcccgcaccgcccccgaaaaagccgggaaaagcgcgcgtgaaaatttcc
ccggtcgcgcggaaaatggcggaagcatcaggcatcaaaccggaagatataatagggacc
ggcccggggggcaggattacaaaagaagatgtggaacaggccattgcgtcggcaaaagaa
agccgcaaacaggacatccccgtccaggcggtggcagaagaaccgcagcgcataccggta
tccggcatgcgcaaagtgatcgcagaacgcatgcatttaagcctgcaatcggctgcacag
ctgacgatcacgatgaaagcggatgtcacggaactattggcgctaaaaacgcaagtgaaa
gagacaattgcaaaacggtacggcagcaaactgacgatcacggattttgcagcaagggct
gccatccttgccctcgaaaaccatccggaaatgaacagtgcgtttatggataacaccatc
gtcacttacctggaaatccatttgggcattgcaacggcggttgaaaaagggcttgttgtc
ccggtcatccgccatgccgaaagcaaatcgctgatcgatctggcaaaagaaatcaaagaa
aaagcagcggcagcaagagccgggaaacttccggcagatgagatgcaagggtccactttc
accatttcaagcctgggtgcaagcggcgtcgaatttttcacgcctattttgaacccgccg
gaagccgggatattgggtgtcggtgccgtttcggatgaagctgtttttatcggggacaaa
attgaaaaacggagccggctgccgctcagcctgacgtttgaccaccgcgtgctcgacggg
gcgccggcagcagccttcctgcaaacggtcaagcaatatttggaagaaccagttacgatg
cttttgtag

DBGET integrated database retrieval system