KEGG   Bacillus coagulans 2-6: BCO26_1433Help
Entry
BCO26_1433        CDS       T01527                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bck  Bacillus coagulans 2-6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BCO26_1433
Enzymes [BR:bck01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BCO26_1433
Exosome [BR:bck04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCO26_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1492301..1494241)
Genome map
AA seq 646 aa AA seqDB search
MENSVKYSQQVLPTDFELYLFHEGTLYESYTLFGAHVMEYEGKKGVRFAVWAPNAQAVAV
AGDFNGWDGSKHQMKRLKDSSIWVLFIPDLAPGELYKYEITGPSGNTFFKADPYAFYSEV
RPKTASVIYDPGTYQWQDRKWMSHKAKSDPYHEPMLIYEMHFGSWKKKANGDFYTYREMA
DELVPYVSGHGYTHIELMPMMEHPFDRSWGYQITGFYAPTSRYGKPEDFMYFIDKCHQNG
LGVILDWVPVHFCKDAHGLGRFDGTPLFEPADPDMAERPIWGTYNFDFQKPEIFSFLISN
AIFWIDVYHIDGFRVDAVSSLIYLNHDRGDEKKLTNQYGGDVNLEAVEFIKKLNEAVFKK
FPHALMIAEEATSWPLVTAPVYAGGLGFNYKWNMGWVHDVLTYMQTPEEKRPDAHDLLTF
SMYYAFSENYVLPFSHDELVYGKKSLLNKMPGDFPQKFANLRLLYAYFMTHPGKKLLFMG
SEFGQFDEWKDLTQLDWMLLDFETHRTFFQFTKALNAFYQNTRSLWRLDHDPEGFEWIDP
NNRRQSIIIFMRRGKRKGDYCIILCNFSKIKYDKFRIGVPSFGKYIEIFNTDDERFGGSG
LLNKEAIQVDKEPFHNQPYSMEISIPPLSALIFKKQSKKRQRGGKK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaactcagttaagtattcgcaacaagtcctgcccactgatttcgagctttactta
ttccacgaaggcaccctttacgaaagctatactttgttcggggcacatgtcatggagtat
gaaggaaaaaagggcgtgcggtttgctgtttgggcgccgaatgcgcaagccgttgccgta
gccggcgattttaacggctgggacggtagcaaacaccaaatgaaacgactcaaagattcg
agcatctgggtgttgtttattccggatctcgcgccgggtgagctgtataaatatgaaatt
acagggccttccggcaacactttttttaaagcggatccatatgcgttctattcggaagtg
cgtccgaaaacggcatctgtcatttatgatcccggcacatatcagtggcaggatagaaaa
tggatgagccacaaagcaaaatccgatccgtaccacgagccgatgctgatttatgaaatg
catttcggttcatggaagaaaaaagccaatggcgatttttacacctaccgtgaaatggca
gacgaactggtcccatacgtttccgggcatggctatacgcatatcgagcttatgccgatg
atggagcatccgtttgaccggtcatggggctaccagattaccggtttctatgcaccgaca
agccggtacgggaagccggaagatttcatgtattttatcgacaaatgccatcagaacggc
ctcggggtgattttagactgggttcccgtccatttctgcaaagacgcccacggactcggg
cgctttgacggaacaccgctgttcgagcctgcagaccctgacatggcggaacggccgatt
tggggtacatacaattttgactttcagaaacctgaaattttcagttttcttatttccaac
gccattttttggatagacgtttatcatattgatggcttccgggtggatgcagtttcttct
ctaatttatttaaaccatgacaggggagacgaaaagaaattgacaaaccaatatggcggt
gatgtcaatttggaagctgtcgagtttatcaaaaaattaaatgaagccgtttttaaaaag
tttccgcatgccttaatgattgcagaagaagcaacatcgtggccgctcgtaacagcgccg
gtttacgcgggcgggctcggttttaattataaatggaatatgggctgggtgcatgatgtg
ctcacctatatgcagacaccggaggaaaaaaggcctgatgcccatgatctcctcaccttt
tccatgtactatgctttttcggaaaactatgtactgcctttttcgcatgatgaactggtt
tacgggaagaaatcgctgctcaataaaatgcccggggatttcccgcaaaaatttgcaaat
ttacgccttctttatgcttattttatgacacatccgggtaaaaaattattattcatggga
agcgaattcggacagtttgacgaatggaaagacctgacgcagctggattggatgctgctg
gattttgaaacgcaccgtaccttctttcagtttacaaaagccttgaacgcattttatcaa
aacacaagaagcttgtggcggctagatcatgaccctgaaggttttgaatggattgatccg
aataatcgtaggcagagcatcataatttttatgagaagagggaagcggaaaggggattat
tgcatcatcctctgtaatttttcaaaaatcaaatatgacaaattccgaattggcgtgcct
tcatttgggaaatatatcgaaattttcaatacggatgatgaacggttcggcggcagtggt
ttgttgaacaaagaagcaatccaagtggataaggagccttttcataaccagccatacagt
atggaaatcagcattcccccactcagtgcattgatctttaaaaagcaatcaaaaaaacgg
caaaggggtggcaaaaaataa

DBGET integrated database retrieval system