KEGG   Bacillus coagulans 2-6: BCO26_1699Help
Entry
BCO26_1699        CDS       T01527                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00010  Glycolysis / Gluconeogenesis
bck00052  Galactose metabolism
bck00500  Starch and sucrose metabolism
bck00520  Amino sugar and nucleotide sugar metabolism
bck00521  Streptomycin biosynthesis
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
bck01200  Carbon metabolism
Module
bck_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bck_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_1699
   00052 Galactose metabolism
    BCO26_1699
   00500 Starch and sucrose metabolism
    BCO26_1699
   00520 Amino sugar and nucleotide sugar metabolism
    BCO26_1699
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCO26_1699
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BCO26_1699
Enzymes [BR:bck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCO26_1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEH53758
UniProt: F7YYY4
Position
complement(1732617..1733420)
Genome map
AA seq 267 aa AA seqDB search
MARAKREKKEITGIGLGVPGPVDMEAGVIYESVNIGWAQHYPVAGTLQKLVGLKVVIDND
ANVAALGEMWKGAGKGSGEMVFVTLGTGVGGGIITGGDIVHGVKGAAGEIGHITVIPEGG
ARCNCGKTGCLETVASATGVVRTAIAKLAAFSGASPLKDLYARSGSVSAKDVFDFAKAGD
ALSYEIVDETAKYLGLALASVANTLNPEKIVLGGGVSKAGETLLNPVRAYFLKYAFNTVG
QSTKLELATLGNDAGVLGAAWLALNKI
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttggcccgggcaaagcgggagaaaaaagagatcacagggatcggcctcggcgtaccgggg
ccggttgatatggaagccggcgtgatttatgaatccgtcaatatcggctgggcgcagcat
tatccggttgccgggacattgcaaaaattggtggggttaaaagtggtgatcgataatgat
gcaaatgttgcggcactcggtgaaatgtggaaaggcgccgggaaaggttccggggaaatg
gtcttcgttacgcttggcaccggtgtcggcggcggcatcattacaggcggggatatcgtc
cacggcgtaaaaggggcggcaggcgaaatcggccatattaccgtcatcccggaaggcggg
gcacgatgcaactgcgggaaaaccggctgccttgaaacggtcgcttccgcaacaggcgtg
gtcaggacagccatagcgaaactggctgcatttagcggcgcgtccccgttaaaagatttg
tatgcccgaagcggatcggtaagcgccaaagacgtgtttgactttgcgaaagcgggagat
gccctttcctacgaaattgttgacgaaacggcaaaatacctcgggcttgcgctggcaagt
gtggccaatacgttaaatccggaaaaaatcgtgttggggggcggggtgtcaaaagcaggc
gaaacgctcttaaacccggtgcgcgcttattttttgaaatacgcgttcaacacggtcggc
caatcgacaaaactggaacttgccacattgggaaacgatgccggcgtactcggggcagcg
tggctggcgttaaataaaatttaa

DBGET integrated database retrieval system