KEGG   Bacillus coagulans 2-6: BCO26_1883Help
Entry
BCO26_1883        CDS       T01527                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bck  Bacillus coagulans 2-6
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCO26_1883
Enzymes [BR:bck01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BCO26_1883
Exosome [BR:bck04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCO26_1883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1913041..1914018)
Genome map
AA seq 325 aa AA seqDB search
MKDLQFARHRRLRQSANMRALVRETNVTVNDLIYPIFAVEGENVKNEIASMPGVYHWSLD
RLHEIMDEVVSLGIKSVILFGVPNHKDATGTEAYHDHGIVQEAIRFIKKNYPDIIVIADT
CLCEYTDHGHCGVVEDGKILNDPSLDLLAKTAVSQAKAGADIIAPSNMMDGFVTAIRKGL
DEAGFEDVPIMSYAVKYASAFYGPFREAADSTPAFGDRKTYQMDPANRLEALREAQSDVE
EGADFLIVKPTLSYLDIVRDVRNEFRLPVVGYNVSGEYSMVKGAAQNGWIDEKAIVLEMI
TSMKRAGCDLIITYFSLDIARWLAE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttgcagtttgcccgccaccgcaggctccgccaaagcgccaatatgcgggct
ttggtgcgcgaaacgaatgtaacagtgaacgacttgatttatccgatttttgctgttgaa
ggcgaaaatgttaaaaatgaaattgcttcgatgccgggtgtgtaccactggtcgctggac
cgcctccatgaaatcatggatgaagttgtttccctcggcatcaaatccgtcattttattc
ggcgtaccgaaccataaggatgcaaccggaacggaagcgtaccacgaccacggcatcgtc
caggaagccatccgtttcatcaaaaaaaattacccggatatcattgtcatcgctgatacc
tgcctgtgcgaatataccgatcacggccattgcggcgttgtggaagacgggaaaatttta
aacgacccgagccttgacctgcttgcgaaaacggcggtcagccaggcaaaagcaggtgct
gatatcattgcgccttcgaatatgatggacggatttgtcacagcgattcgcaaagggctt
gatgaagcaggctttgaagatgtgccgatcatgagttatgcggtcaaatacgcatccgct
ttttacggcccgttccgcgaagccgctgacagcacccccgctttcggggaccggaaaacc
taccagatggatccggccaaccggctcgaagcattgcgtgaagcgcagtcggatgtggaa
gaaggggcggattttctgatcgtaaaaccgacgctttcttatcttgatatcgtccgtgat
gtgcggaatgaattccgccttccagttgtcgggtataatgtgagcggagagtattctatg
gtaaaaggcgctgcacaaaacggctggattgatgaaaaagcgattgttcttgaaatgatc
acaagcatgaaacgcgccggctgcgatctcatcattacctatttttcactcgatattgcc
cgctggcttgcggaataa

DBGET integrated database retrieval system