KEGG   Bacillus coagulans 2-6: BCO26_1921Help
Entry
BCO26_1921        CDS       T01527                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00071  Fatty acid degradation
bck00362  Benzoate degradation
bck01100  Metabolic pathways
bck01120  Microbial metabolism in diverse environments
bck01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BCO26_1921
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCO26_1921
Enzymes [BR:bck01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCO26_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEH53980
UniProt: F7YZB7
Position
complement(1949614..1950387)
Genome map
AA seq 257 aa AA seqDB search
MEFITIKRENAVACIEMNRPPANALAQVLLKELAQAFGQLENDPETRVVLLYGKGRFFSA
GADIKEFVQLRESGGSDAIAVSGQELFEKVEAFPKPVIAAIHGAALGGGLELAMACHIRL
VTENAKLGLPELSLGLVPGFAGTQRLPKYIGRGKAFEMLWTSEPLTGTEAVQQGLANHAY
KEEELLPKAKALAEKIAKKSPLALKASIELVNYAKTNDYEKGLEQESARFLELFGSKDAE
EGIKAFIEKREPRFTGA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaatttattacgatcaaacgggaaaatgcggttgcctgcattgaaatgaacaggccg
cccgccaacgcgcttgcgcaggtccttttaaaagaacttgcgcaagcgtttggccagctt
gaaaacgatcctgaaacccgggtcgtgctcctttacgggaaaggaagatttttctcggcg
ggagcggatattaaagaatttgtccaattaagggaatccggcggctccgatgcgatagcg
gtttccggccaggaattgttcgagaaagtggaagcgttcccgaaaccggtcatcgccgca
atccacggcgcggcacttggcggcgggctcgaacttgcgatggcatgccatatccggctt
gtcacagaaaatgcgaagctcggccttccggaactgagccttgggcttgtgccgggtttt
gccggaacgcagcggctgccaaagtatatcgggcgcggcaaagcgtttgaaatgctgtgg
acaagcgaaccgctgaccggaacggaggccgtgcagcaggggcttgcaaaccatgcttat
aaggaagaggaactgctcccgaaagcaaaggcgctggctgaaaaaattgcaaagaaaagc
ccgctggccctgaaagcctctattgaactcgtcaattatgcaaaaacaaatgattacgaa
aaaggcttggagcaggaatccgcacgttttcttgagctgttcggctcaaaagatgcagag
gaaggtatcaaagcttttattgaaaaaagggaaccgcgttttacaggggcataa

DBGET integrated database retrieval system