KEGG   Bacillus coagulans 2-6: BCO26_1921Help
Entry
BCO26_1921        CDS       T01527                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bck  Bacillus coagulans 2-6
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BCO26_1921
  Lipid metabolism
   00071 Fatty acid degradation
    BCO26_1921
Enzymes [BR:bck01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCO26_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1949614..1950387)
Genome map
AA seq 257 aa AA seqDB search
MEFITIKRENAVACIEMNRPPANALAQVLLKELAQAFGQLENDPETRVVLLYGKGRFFSA
GADIKEFVQLRESGGSDAIAVSGQELFEKVEAFPKPVIAAIHGAALGGGLELAMACHIRL
VTENAKLGLPELSLGLVPGFAGTQRLPKYIGRGKAFEMLWTSEPLTGTEAVQQGLANHAY
KEEELLPKAKALAEKIAKKSPLALKASIELVNYAKTNDYEKGLEQESARFLELFGSKDAE
EGIKAFIEKREPRFTGA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaatttattacgatcaaacgggaaaatgcggttgcctgcattgaaatgaacaggccg
cccgccaacgcgcttgcgcaggtccttttaaaagaacttgcgcaagcgtttggccagctt
gaaaacgatcctgaaacccgggtcgtgctcctttacgggaaaggaagatttttctcggcg
ggagcggatattaaagaatttgtccaattaagggaatccggcggctccgatgcgatagcg
gtttccggccaggaattgttcgagaaagtggaagcgttcccgaaaccggtcatcgccgca
atccacggcgcggcacttggcggcgggctcgaacttgcgatggcatgccatatccggctt
gtcacagaaaatgcgaagctcggccttccggaactgagccttgggcttgtgccgggtttt
gccggaacgcagcggctgccaaagtatatcgggcgcggcaaagcgtttgaaatgctgtgg
acaagcgaaccgctgaccggaacggaggccgtgcagcaggggcttgcaaaccatgcttat
aaggaagaggaactgctcccgaaagcaaaggcgctggctgaaaaaattgcaaagaaaagc
ccgctggccctgaaagcctctattgaactcgtcaattatgcaaaaacaaatgattacgaa
aaaggcttggagcaggaatccgcacgttttcttgagctgttcggctcaaaagatgcagag
gaaggtatcaaagcttttattgaaaaaagggaaccgcgttttacaggggcataa

DBGET integrated database retrieval system