KEGG   Bacillus coagulans 2-6: BCO26_1968Help
Entry
BCO26_1968        CDS       T01527                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bck  Bacillus coagulans 2-6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCO26_1968
   01230 Biosynthesis of amino acids
    BCO26_1968
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_1968
   00030 Pentose phosphate pathway
    BCO26_1968
   00051 Fructose and mannose metabolism
    BCO26_1968
   00052 Galactose metabolism
    BCO26_1968
  Energy metabolism
   00680 Methane metabolism
    BCO26_1968
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BCO26_1968
Enzymes [BR:bck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCO26_1968
Protein phosphatases and associated proteins [BR:bck01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BCO26_1968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1998197..1999159)
Genome map
AA seq 320 aa AA seqDB search
MKRIGVLTSGGDAPGMNAAVRAIARKGIYHGLEVYGIHQGYNGLIQGNIQKLEAGSVGDI
LQRGGTVLQSARSEEFKTPEGQQKAIRQLKDHGIEALVVIGGDGSYQGAKKLTEQGFNCI
GVPGTIDNDIPGTDFTIGFDTALNTVLDAIDKIRDTASSHERTFIIEVMGRNAGDIALWS
GLAGGAESIIIPEEKFDLKDVVERLEQGRKRGKRHSIIIVAEGVMSGNEFAEQLKKTGVI
GDTRVSVLGHIQRGGSPTAFDRVLASRLGARAVELLLEGKGGRAVGIQNNQLVDHDILEI
LGKPHAVNKNMYKLSKELSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaattggagtattgacaagcggcggcgatgcaccggggatgaatgcggcggtc
cgcgcgattgcccgtaaagggatttatcacggcctggaagtttacggcattcaccaaggt
tataacggattgattcaaggaaacatccaaaagctcgaagcaggatctgttggcgatatt
ctccagcggggcggcacggttttgcagtcggcaagaagcgaagaattcaaaacgccggaa
gggcagcaaaaagcgatcaggcagctgaaagaccatggcattgaagcgctcgttgtgatc
ggcggcgacggttcctaccaaggggccaaaaaattgacggaacagggctttaactgcatt
ggtgtgccagggacaatcgataacgacatcccggggacggattttacaatcggttttgat
acggcattgaacacagtgcttgatgcgattgataaaattcgcgacaccgcttcttcccat
gaacgcacctttattattgaagtcatgggcagaaatgccggggatatcgcgctctggtcc
ggcctggccggcggagccgaatcgattattattccggaagaaaaatttgacttaaaagat
gtcgtggagcgtcttgaacaggggagaaaacgcggcaaacgccacagcatcatcattgtc
gcggaaggcgtgatgagcggcaacgagtttgctgaacaattgaaaaaaaccggtgtgatc
ggcgatacccgcgtttctgttctcggccatatccagcgcggcggttctccgacggcattt
gaccgcgtgcttgcaagccgcctcggcgcaagggctgttgaactgctgcttgaaggaaaa
gggggccgcgctgtcggcattcaaaataaccagctggttgaccacgatatccttgagatt
ctcggaaaaccgcacgccgttaataaaaacatgtacaagctgtcgaaagaattgtcgatc
taa

DBGET integrated database retrieval system