KEGG   Bacillus coagulans 2-6: BCO26_2022Help
Entry
BCO26_2022        CDS       T01527                                 

Gene name
acsA
Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bck  Bacillus coagulans 2-6
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bck01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bck00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bck00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bck00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bck00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2053697..2055415)
Genome map
AA seq 572 aa AA seqDB search
MKLEALPTVQGDFNLKNYEETRKTFSWKDAEKNFSWYETGRVNLAYEAIDKHAESSRKNK
VALMYLSDSRNEKYTYYEMKRLTNKAANVLKEKAGVQKGDRVFIFMPRSPELYFAMLGAI
KLGAIVGPLFEAFMEGAVKDRLEDSEAKVLVTTPDLVGRVPAGQLPALETIFVVGENVKE
EGKYKDYLKYFNEASDKLEIEWVDREDGLILHYTSGSTGKPKGVLHVHNAMIQHYQTGKW
VLDLKEDDIYWCTADPGWVTGTSYGMFAPWLNGATNVVVGGRFSPAAWYRTIERFGVTVW
YSAPTSFRMLMGAGNEIINQYDLSTLRHILSVGEPLNPEVIRWGNEVFGLRIHDTWWMTE
TGAQLICNYPCMDIKPGSMGKPLPGIEAAIVDDQGNPLPPNRMGNLAIKKGWPSMMRAIW
NNPQKYESYFFPNGWYVSGDSAYMDEDGYFWFQGRVDDVIMTSGERVGPFEVESKLIEHP
AVAEAGVIGKPDPVRGEIIKAFIALRDGYEPSDEMKEEIRQFVKKGLAAHAAPREIEFCE
KLPKTRSGKIMRRVLKAWELDLPAGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggaagcgttaccaaccgtacaaggggatttcaatctgaaaaactatgaagaa
acccgcaaaacgttcagctggaaagacgccgagaaaaatttttcatggtatgaaactggg
cgtgtcaacctggcgtatgaagccattgacaaacatgcggaaagctcccgcaaaaataaa
gtagcgctcatgtacttaagtgattcacgcaacgagaaatatacttactatgaaatgaaa
aggctgacaaacaaggcggcaaatgttttaaaagaaaaagcgggcgtccaaaaaggtgac
cgtgttttcatctttatgccgcgctctccggaactgtattttgccatgcttggcgccatc
aagctcggcgccattgtcggcccgctgtttgaagcgtttatggaaggggctgtaaaagac
cgccttgaagacagtgaagcgaaagtgcttgtgacaacccctgaccttgtcgggcgtgtc
ccggccggccagcttccggcattggaaaccatctttgttgtcggggaaaatgtcaaagaa
gaaggaaagtacaaagactacctgaaatattttaacgaagcttccgataaactggaaatc
gaatgggttgaccgggaagacgggctgatcctccactatacgtccggttcaaccggaaag
ccaaaaggcgtcctccatgtccataatgccatgatccagcattaccagacgggaaaatgg
gtgcttgatttaaaagaagatgatatttactggtgcacggcagacccgggatgggtaacg
ggaacttcttacggcatgtttgcgccatggttaaacggcgcaacaaacgtcgttgtcggc
ggccgcttcagcccggcagcgtggtacagaacgattgaacggttcggcgtcaccgtttgg
tacagcgccccgacttcgttccggatgctgatgggggccggcaatgaaatcattaaccaa
tatgacctctcgacattgcgccatattttaagtgtcggtgaaccgctgaatccggaagtg
atccgctggggcaatgaagtattcgggctccgcatccatgatacatggtggatgacggaa
accggcgcacagctgatctgcaactatccttgcatggatatcaaaccgggatcgatgggg
aaaccgctccctggcattgaagcggccattgttgatgaccagggaaatccgcttccgccg
aaccggatgggcaatctcgccattaaaaaaggctggccttccatgatgcgtgccatctgg
aacaacccgcaaaaatatgaatcttactttttcccgaacggctggtacgtttccggtgac
tcggcttatatggacgaggacggctatttctggttccagggccgcgtggacgatgtcatc
atgacgtccggcgagcgggtcgggccgtttgaagtggaaagcaaactgatcgaacatccg
gccgttgcggaagccggcgtcatcggcaagccggatccggtccgcggcgaaattattaaa
gcctttatcgctttaagggatggatacgaaccgtcagatgagatgaaggaagaaatccgc
caatttgtgaaaaaagggttggctgcccatgccgcgccgcgggaaatcgagttttgcgaa
aaactgccgaaaacccggagcgggaaaatcatgcgccgcgtcctgaaagcctgggaactg
gatctgccggccggggacctttcgacaatggaagattga

DBGET integrated database retrieval system