KEGG   Bacillus coagulans 2-6: BCO26_2052Help
Entry
BCO26_2052        CDS       T01527                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bck  Bacillus coagulans 2-6
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bck01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bck00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2079073..2080491)
Genome map
AA seq 472 aa AA seqDB search
MADIHWMEEVLKRKEDLIRDLKGILQIRSVLDEANATEEAPLGQGVREALQYMLDLGEKD
GFKTKNVQNLAGHLEMGEGEDILGILGHVDVVPEGDGWTVDPYSGTVKDGKIYARGSSDD
KGPTMAAYYGMKIVKELGVPLEKRVRLIVGTDEESNWRCMDAYFSNEEMPAIGFSPDADF
PIIYAEKGIADFDIIQDPEKTEDPQQVELLSFESGRRYNMVPDYAEARLVAHGEQTELLQ
KFQDYQKETGLAGQDFVDGGVLILKLEGVSAHGAEPENGKSAGLYLAKFLNSVALDRAGA
KFIKTLNQFFGRSRGEYFGIGYKDEVSGELTINIGIMSYHQEKGGRIGLNMRYPVTFDLE
AGKTKIVSKLKKDGLRFDHFSDQKPHYVDKNDPLITTLAKVYEEQTGEEAKLLAIGGGTY
ARTLKKGVAFGALFPGREDVMHQKDEYMYVEDLLKATAIYAQSIYELAGKHA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggccgatatccactggatggaagaagtattaaaaaggaaagaggatttgatccgcgat
ctgaaagggattttgcagatcaggagcgttctcgatgaagcgaatgcaacggaagaagca
ccactcgggcaaggcgtcagggaggcgctccaatatatgctcgatctcggtgaaaaagac
gggttcaaaacgaaaaatgtgcaaaatctcgccggccaccttgaaatgggggaaggagaa
gacattctcgggatcctcgggcatgtcgatgtagtgccggagggggacggctggacagtt
gacccgtacagcggcacagtcaaagacgggaaaatttatgcgcgcggctcaagcgacgac
aaaggcccgacaatggcggcttattacggcatgaaaattgtaaaagaactcggggtgcca
cttgaaaaaagggtgcgcctcattgtcgggacagatgaagaaagcaactggagatgcatg
gacgcctatttttcaaacgaggaaatgccggccatcgggttttcgccggatgccgacttc
ccgatcatttatgcggaaaaagggattgccgattttgacattatccaggatccggaaaaa
acggaagacccgcagcaggtggaactgctttcttttgaatcggggcgccgctacaatatg
gtgccggactatgcggaggcacgccttgtcgcgcacggcgagcagacggaacttttgcaa
aaattccaggattatcagaaggaaaccgggcttgccgggcaggatttcgtggacggcggc
gttttgattttaaagctggaaggcgtttcggcccatggcgcggaaccggaaaacggaaaa
agcgcggggctttatctggcaaaatttttaaacagtgtggcgcttgaccgtgccggggca
aaattcatcaaaacgctcaaccagttcttcggccgttcacgcggtgaatatttcggcatc
gggtacaaagatgaagtttccggggaattgacgatcaatatcgggatcatgtcctatcat
caggaaaaaggcggccgcataggattaaatatgcgttatcccgttactttcgatcttgaa
gcaggaaaaacaaaaattgtgtcgaaattaaaaaaagacggcttgcgtttcgatcatttt
tccgatcagaaaccgcattatgttgacaaaaatgacccgctgattacgacgcttgcgaaa
gtgtacgaggagcagaccggagaggaagcgaagctattggcaatcggcggtggtacatat
gcacgtacccttaaaaaaggtgtggcatttggggcgcttttcccgggacgcgaagatgtc
atgcaccaaaaagatgagtacatgtatgtggaagatttgctcaaagcaacggcgatttat
gcacagtccatttatgaactggccgggaagcacgcgtga

DBGET integrated database retrieval system