KEGG   Bacillus coagulans 2-6: BCO26_2063Help
Entry
BCO26_2063        CDS       T01527                                 

Definition
alpha/beta fold family hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bck  Bacillus coagulans 2-6
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BCO26_2063
Enzymes [BR:bck01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BCO26_2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2091927..2092733)
Genome map
AA seq 268 aa AA seqDB search
MWKWEADENPKAVIVMVHGAMEHHRRYSWLIEMWRSSGYHVVMGDLPGHGMTSRAKRGHI
DSFDEYTTEIKEWVTAAYQFDLPIFLLGHSMGGLAVIRLLEKEHLKIAGVMLSSPCLGLV
QYPSKLLGLLSIGLNRIAPGLRFNSPLTVQMATRNKDIQMQAVNDSLMLTKVSVRWYREL
LAAMRQAHMDTVRLPDVPFLVMQAGSDKIVDKGAVVNWFNQTSVSEKLYKEWPKCYHEIF
NEPEREDVFLYAKNFVENRLRTLGYILE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatgggaagcagatgaaaacccaaaagcagtcatcgtcatggtccatggcgcg
atggaacatcaccgccgctacagctggctgattgagatgtggagatcaagcggctatcat
gttgtgatgggcgatcttcccggccatgggatgacgtcgagagcaaaaagggggcatatt
gattcctttgatgaatatacaacagagataaaagagtgggtgacggcagcataccagttc
gacctcccgatttttctcctcggccacagcatgggcgggctggcggtcatccggctgctt
gagaaggaacatctgaaaattgcgggggttatgctttcctcgccgtgcctcgggcttgtc
cagtatccttcaaagctgctcggcctgctttcaatcgggttaaaccggattgccccgggc
ctccgctttaacagcccgctgaccgtgcaaatggcaacacggaataaggatattcaaatg
caggcggtcaacgattcattgatgctgacaaaagtgtctgtccgctggtaccgcgagctg
ctcgcagccatgcggcaggcacacatggataccgtgcggctgccggacgtcccgtttctt
gtcatgcaggccggaagtgataaaattgtggacaagggagctgtcgtgaattggtttaac
caaacttccgtgtccgaaaaattatacaaagaatggccgaaatgttaccatgaaattttc
aatgaaccggagagggaagatgttttcctttatgcgaaaaattttgtggaaaaccggctc
cgcacgttaggctatatattagaatga

DBGET integrated database retrieval system