KEGG   Bacillus coagulans 2-6: BCO26_2065Help
Entry
BCO26_2065        CDS       T01527                                 

Gene name
ansB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bck  Bacillus coagulans 2-6
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bck00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2093623..2095437)
Genome map
AA seq 604 aa AA seqDB search
MIEHRGPDDEGFYEDEHIQFGFRRLSIIDIEAGHQPLTYENERYWIIFNGEIYNYVELRE
ELLKEGMAFETNSDTEVILAMYSRYGEKAIGRLRGMFGFAIWDKQEQTLCGARDPFGIKP
FFYYEDGDKMYFGSEKKSILLAMEKPELNYDAVQYYLTYQFVPEPFSMTSGIRKLEPGHY
FMKKIGKPMEIKQFWKASFHPVHKSEDEFVKEVRDVLIDSVKVHMRSDVPVGAFLSGGID
SSITASIAKQFHPGIKTFSVGFERDGYSEIDVAKETAEKLGVENISYVITPEEYMKELPK
IIWHMDDPLADPACVPLYFVAREARKHVTVVLSGEGADELFGGYNIYREPQSLEVFDKIP
AAGKSILKALAKVLPEGVKGKSFIERGVTPMEDRYIGNAKMYTEEEKRDLLLTYNNSLDY
RDITKPLYDETKGYDPVDRMQYIDIHTWMRGDILLKADRMTMAHSLELRVPFLDKEVFRV
ASQIPAGLKTSHNTTKYILRKAVEGIVPDHVLNRKKLGFPVPIRHWLKDEMHDWAVEIIK
TSPTDDIINKQYVLKLLEDHCAGKLDYSRKIWTVLIFMLWHAVYMEDKYDFQKGTQGRLA
GASL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagcaccgtggcccggatgatgaaggcttttatgaagacgaacatatccagttc
ggtttcaggcgcctgagcattatcgacatcgaggcggggcaccagcctttaacatacgaa
aacgaacggtactggatcatttttaatggcgaaatttataattatgttgaattgcgtgaa
gaattattaaaagaagggatggcattcgaaacgaattcggatacggaagtcatccttgcc
atgtacagccgttacggcgaaaaagcaatcgggcgactgcgcgggatgttcggatttgcg
atctgggataagcaggaacaaacgctgtgcggcgcgcgcgacccgttcggcattaaaccg
tttttctattatgaagacggcgataaaatgtatttcggttccgaaaagaaaagcattttg
cttgccatggaaaaaccggaactcaattatgatgctgtccaatactatttaacctatcaa
tttgtgccggaacctttcagcatgacgagtggcatccgaaaactcgaaccgggccattat
tttatgaaaaaaatcggcaaaccgatggaaatcaaacagttctggaaagcttccttccac
ccggtccataagagcgaggacgaatttgtaaaagaagtgcgcgatgtgcttatcgattcc
gtaaaggtacatatgcgcagcgatgtaccggttggcgcgttcctgtcgggcgggatcgat
tcctcgattacggcatcgattgcaaaacagttccacccgggcattaaaacattctccgtc
ggattcgaacgcgatggctacagcgagattgatgttgccaaagaaacggcggaaaaactc
ggtgttgaaaatatcagctatgtgatcacgccggaggaatatatgaaagaactgccaaaa
attatttggcatatggacgatccgctcgcagatcctgcttgtgttcccctttattttgtg
gcgcgcgaagcaagaaagcatgtgaccgttgtcctgtccggcgaaggcgcggatgaattg
ttcggcggctataatatttaccgtgaaccgcagtcgcttgaagtttttgataaaattccg
gctgccggaaaatcaattttgaaggctttggcgaaagtgctgccggaaggggtaaaagga
aagagctttatcgaacgcggtgtcacgccaatggaagaccgttatatcggcaatgcgaaa
atgtacacggaagaagaaaaacgcgacttgctgttgacttataacaacagccttgactac
cgcgatatcacaaagccgctgtacgatgaaacgaaaggctacgacccggttgaccggatg
caatatatcgatatccatacgtggatgcgcggcgatattttgctgaaggcggaccggatg
acgatggcccattcgcttgaactgcgtgtgccgtttttggataaagaagtgttccgggtc
gcttcacaaattccggcgggcttaaaaacgtcccataacacaacgaagtatattttgcga
aaagcagtggaaggcatcgtgccagaccatgtgctgaaccggaaaaaactcgggttcccg
gttccgatccgccactggctgaaagatgaaatgcatgattgggcggtagagatcatcaaa
acgagcccgacggacgacatcatcaacaaacaatatgtattaaaactgctggaagaccat
tgtgcaggcaagctggattacagccggaaaatctggaccgtgctgattttcatgctgtgg
catgccgtgtatatggaagacaagtacgattttcaaaaaggaacacaagggcggcttgcc
ggcgcttcgttgtaa

DBGET integrated database retrieval system