KEGG   Bacillus coagulans 2-6: BCO26_2233Help
Entry
BCO26_2233        CDS       T01527                                 

Definition
alpha/beta-hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bck  Bacillus coagulans 2-6
Brite
Enzymes [BR:bck01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BCO26_2233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2258786..2259535)
Genome map
AA seq 249 aa AA seqDB search
MMRIVPPKPFLFEAGKRAVLLLHGFTGSSADVRMLGRFLEKKGYTCHAPQYKGHGVPPEN
LLHTGPSDWWQDVMNGYQLLKEKGYHEIAVAGLSLGGVFSLKLGYTVPVKGIITMCAPMY
IKSEQTMYEGVVAYARKYKQFEGKSEAQIEQEMREFKKTPMHTLQSLQELIQDVRNHVDH
IYAPVFVVQARHDEMIRPESANIIYSEVETDHKQLKWYENSGHVITLDGEKDQLHEDVYT
FLESLDWSV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaattgtaccacccaaaccgtttttatttgaagccggcaagagggctgtactg
cttttgcacggatttaccggaagcagcgccgatgtcaggatgctcgggcgcttccttgaa
aaaaaaggatacacttgccatgcgccgcaatataaagggcacggggtaccgcctgaaaat
cttttgcatacgggcccaagcgactggtggcaggatgtcatgaacggctaccagttattg
aaagaaaaagggtatcatgaaattgcagtggccggattgtcactgggcggggtattttcc
ttaaaattgggttacactgtacctgtaaagggaattatcaccatgtgcgcgcccatgtac
ataaaaagcgagcaaacgatgtatgaaggcgtggttgcgtatgcccgcaaatataaacag
ttcgaagggaaaagcgaagcgcagatcgaacaggaaatgcgggaatttaaaaaaacgccg
atgcatacgctgcaatcgctgcaagagcttattcaggatgtgcgcaaccatgtcgatcac
atttatgcgcctgtttttgtcgtacaagcgcgccatgatgaaatgatccgtccggaaagc
gccaatattatttattcagaagtggaaacagaccataagcaactcaaatggtatgagaac
tccggccatgtcattacactcgatggcgaaaaagaccaacttcacgaagatgtatacaca
tttctggagtcgcttgactggtcggtttaa

DBGET integrated database retrieval system