KEGG   Bacillus coagulans 2-6: BCO26_2238Help
Entry
BCO26_2238        CDS       T01527                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bck  Bacillus coagulans 2-6
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCO26_2238 (tpiA)
   01230 Biosynthesis of amino acids
    BCO26_2238 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_2238 (tpiA)
   00051 Fructose and mannose metabolism
    BCO26_2238 (tpiA)
   00562 Inositol phosphate metabolism
    BCO26_2238 (tpiA)
Enzymes [BR:bck01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCO26_2238 (tpiA)
Exosome [BR:bck04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCO26_2238 (tpiA)
  Exosomal proteins of bladder cancer cells
   BCO26_2238 (tpiA)
  Exosomal proteins of melanoma cells
   BCO26_2238 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2263412..2264173)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLPEALAFVEEVKHSVPGESVVDSVICAPALFLERLVEATKGTRVK
IGAQNMHYEESGAFTGEISPVALADLHVEYVILGHSERREMFNETDEAVNKKVKAAFAHH
LTPIVCVGETLAQRENNETKQIVGSQVKAAFSGLSGDEAKQVVVAYEPIWAIGTGKSSTA
EDANEVCAYIRSAIADQFSQDVADSVRIQYGGSVKPGNIKEFMEQPDIDGALVGGASLDP
QSYLQLLEAVSHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtaaaccgatcattgcggggaactggaaaatgaataaaaccttgccggaagcgctg
gcttttgtcgaagaggtaaaacattcggtacctggcgaatctgttgtcgacagcgtcatc
tgtgcgcctgcgctctttttggaacgcctggtggaagcaacaaaaggcacccgcgtaaaa
attggcgcccaaaacatgcactatgaagaaagcggtgcttttacaggcgagatcagcccg
gttgcactcgcggatttgcatgttgaatatgtcatcctgggacactctgaacgccgtgaa
atgtttaatgaaacggatgaagcagtcaataagaaagtgaaagctgcttttgcccatcat
ttaacaccaatcgtatgcgtgggagaaacactggcacaacgggaaaacaatgaaacaaaa
caaatcgtcggttcacaggtaaaagctgctttttccgggctttccggcgacgaggcaaaa
caggttgtcgttgcctatgaacctatctgggcaatcggaacaggcaaatcttcgactgcc
gaagatgccaacgaagtttgtgcctatatccgtagtgccatcgcggaccaattcagccag
gatgttgctgacagtgtccgaattcaatacggcggcagtgtaaaacccggcaacattaaa
gaattcatggaacaaccggatattgacggtgcattagtgggcggcgcaagccttgacccg
caatcttatttgcaattattggaggcggtaagccatgagtaa

DBGET integrated database retrieval system