KEGG   Bacillus coagulans 2-6: BCO26_2344Help
Entry
BCO26_2344        CDS       T01527                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00260  Glycine, serine and threonine metabolism
bck00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01130  Biosynthesis of antibiotics
bck01230  Biosynthesis of amino acids
Module
bck_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCO26_2344 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCO26_2344 (trpA)
Enzymes [BR:bck01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCO26_2344 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA
Motif
Other DBs
NCBI-ProteinID: AEH54401
UniProt: F7Z098
Position
complement(2375498..2376289)
Genome map
AA seq 263 aa AA seqDB search
MGKQKLEAQFESVLARGDQAFVPYIMAGDGGMEETEKRLAFLEACGATAIELGIPFSDPV
ADGPVIQAAGLRAFKAGTTMKKVLGHLKAHPRQVPVILMTYFNPVFAYGVEKFAADCAAA
GVDGLIIPDLPIEEEEVIAGELATCGLALIRLAAITSPKDRLKKIASRSEGFLYAVTVTG
TTGTRTNFHDNIEDYLAFLSSISRVPVLAGFGVSSPGQVRRLTRYCSGVVAGSKIIELFQ
RGETEKIRALVESAKQQAAPNQL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacaaaaattggaagcacagtttgaatcggttcttgcacgcggtgatcaagca
tttgtcccttatattatggcgggggacggcggaatggaagagacggagaaaaggcttgcg
tttttggaagcttgcggggcaacggcaattgaacttggcatcccgttttccgaccctgtc
gcagacggtccggtcatccaggcggccggactccgcgcttttaaggcaggcacgacaatg
aaaaaagtgctgggccatttaaaagcccatccgaggcaagttccggttattcttatgacg
tatttcaacccggtttttgcctacggggtggaaaaatttgcagcagactgcgcggctgcc
ggtgttgacgggctgattattccggatttgccaatcgaggaagaagaggtaattgccgga
gaactggcaacatgcggccttgcgctcatccggctggctgccattacaagcccgaaagat
aggcttaagaaaatcgcctcccgttccgaagggtttctgtacgctgttacggtcaccggc
acaaccggcacccgcacaaatttccacgacaatatcgaggattacctggctttcttatca
agcatcagccgggtgcctgttcttgccggctttggcgtttccagcccggggcaagtccgc
cgtttaacccgctactgcagcggcgtggtggccgggagcaaaatcatcgagctcttccag
cgcggggaaacggaaaaaatccgtgcgcttgtggaaagcgcaaagcaacaagcagcacca
aaccagctgtaa

DBGET integrated database retrieval system