KEGG   Bacillus coagulans 2-6: BCO26_2550Help
Entry
BCO26_2550        CDS       T01527                                 

Gene name
bsaA
Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bck  Bacillus coagulans 2-6
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BCO26_2550 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BCO26_2550 (bsaA)
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BCO26_2550 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2618578..2619051
Genome map
AA seq 157 aa AA seqDB search
MSIYDYSFERLTGEEEESLAKYKNQVLLIVNTASKCGFTPQYEGLEHLYEKYKDKGFAVL
GFPSDSFMKQEFDESEKIAAFCQANYGVTFPLFKKSKMKGKEMNPLFAELLEQAGEKKIT
WNFNKFLVDRHGHVIGYYGSRTKPEELEAKIEELLQV
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttacgactattcttttgaacggcttactggagaagaggaagagtctttggcc
aaatataaaaaccaggtgctgcttattgtcaatacggcaagcaaatgcggatttacaccc
cagtatgaggggcttgagcacctttacgaaaagtacaaagacaaggggtttgccgtgctt
ggctttccgagcgacagtttcatgaaacaggagtttgacgaaagcgaaaaaattgcagca
ttttgccaagccaactatggcgtaacattcccgttgtttaaaaaaagtaaaatgaagggg
aaagaaatgaacccgctgtttgccgaattgctcgagcaggcaggggagaaaaaaattaca
tggaattttaataaatttctcgtcgaccggcacggccatgtcatcggctattacggctca
cggacaaaaccggaagagctggaggcaaagattgaggaactgctgcaggtatag

DBGET integrated database retrieval system